Detect substitution-cipher garbled text from broken ToUnicode CMaps (#120)

* fix(lib): detect substitution-cipher garbled text from broken ToUnicode CMaps

ParseBench text_simple__att10k.pdf (issue #118) ships Type0/Identity-H
fonts whose ToUnicode CMaps are authored garbled: every bfrange maps with
a wrong constant delta, so text extracts as pure-ASCII ciphertext
("Certificate" -> "8VceZWZTReV"). The embedded subset font has no cmap
table and no glyph names, so no decode source can recover the real text
(poppler and mupdf emit the same ciphertext). The only correct behavior
is to flag the page for OCR instead of serving the garbage silently --
but the text is 100% printable ASCII with word-like tokens, so it slipped
past is_garbage_text and detect_encoding_issues.

Add CipherGarbleStats, a letter-statistics discriminator that flags a
Latin-dominant sample (>=200 ASCII letters) when vowels are starved
(<=30% of letters) AND either:
- lowercase->uppercase transitions inside words exceed 10% of letter
  bigrams (a shifted lowercase alphabet straddles the ASCII uppercase
  block), or
- the letter histogram's cosine similarity against English letter
  frequencies drops below 0.60 (catches shifts that stay within case
  blocks).

Wired into analyze_text_quality (per-page, item-level) and
detect_encoding_issues (markdown-level), so extract_pages_markdown
reports needs_ocr + suspected_garbled_text and suppresses the garbage.

Thresholds validated against the 380-document pdf-evals snapshot corpus
(Swedish, Finnish, Turkish, German, romaji, schematics, all-caps and
camelCase-heavy docs): zero false positives, and byte-identical eval
output vs main. Garbled page measures vowel ratio 0.245 / case-shift
rate 0.225 / cosine 0.532; closest legitimate document on each axis is
0.264 / 0.021 / 0.801.

Fixes #118

Co-Authored-By: Claude Fable 5 <noreply@anthropic.com>

* chore: bump pdf-inspector to 0.1.4, npm package to 1.9.11

Co-Authored-By: Claude Fable 5 <noreply@anthropic.com>

* fix(lib): exempt uniform-case structured content from cipher detection

Address PR review (cubic P2): the frequency branch (english_cosine < 0.60)
fired on any Latin-dominant, low-vowel letter distribution unlike English,
so non-linguistic ASCII — DNA/protein sequences, ticker symbols, hex dumps —
could be suppressed and routed to OCR despite not being garbled. Measured:
DNA cosine 0.428 / vowel ratio 0.260, protein 0.738, tickers 0.747, hex
0.549 — all would have flagged.

Add a mixed-case guard to looks_garbled: garbled English is a permutation of
natural language and carries sentence capitalization (block-straddling shifts
invert the ratio — att10k is 60% uppercase; in-case Caesar shifts preserve it
at ~3%), so both keep some of each case. The exempted structured content is
uniform case (all upper or all lower). Requiring the minority case to be >=1%
of ASCII letters exempts single-case sequences while preserving both garble
signals, including the in-case-shift scenario the frequency branch exists for.

Strictly tightens the detector: it can only remove flags, so the eval corpus
stays at zero false positives (verified byte-identical to a baseline main
binary across all 185 PDFs) and att10k remains flagged. Adds regression tests
for DNA, protein, tickers, and an in-case Caesar shift.

Co-Authored-By: Claude Fable 5 <noreply@anthropic.com>

* fix(lib): make cipher detection case-agnostic via sorted-histogram shape

Address PR review follow-up: the mixed-case guard from the previous commit
returned before the vowel/frequency checks, creating a blind spot — a
uniform-case (all-lower or all-upper) substitution cipher is a plausible
broken-CMap output and would bypass OCR entirely.

Replace the case proxy with the actual invariant. A substitution cipher is
a bijection over a real language's alphabet, so it preserves the frequency
SHAPE (the sorted histogram) while scrambling letter POSITIONS (the unsorted
histogram). Signal 2 now flags when english_cosine < 0.60 (positions unlike
English) AND english_shape_cosine >= 0.90 (profile is still English-shaped).
This is independent of case, so it catches all-lower, all-upper, and
case-straddling shifts alike.

The exempted structured content fails one half: DNA/hex dumps have too steep
a profile (shape cosine 0.74 / 0.81 < 0.90), while protein sequences, ticker
symbols and base64 are not sufficiently unlike English in position (unsorted
cosine 0.74 / 0.75 / 0.77 >= 0.60). All stay out of OCR.

Still strictly corpus-safe: every real Latin document scores unsorted cosine
>= 0.70 (min 0.80), far above the 0.60 gate, so none can reach Signal 2.
Re-verified byte-identical to a baseline main binary across all 185 eval
PDFs; att10k remains flagged. Drops the now-unused case counters and adds
all-lowercase / all-uppercase shifted-prose regression tests.

Co-Authored-By: Claude Fable 5 <noreply@anthropic.com>

* chore: source Python package version from Cargo.toml via maturin

Address PR review (cubic P2): pyproject.toml pinned version = "0.1.0",
which overrides Cargo.toml, so a maturin build produced a 0.1.0 Python
artifact regardless of the crate version (it had drifted since the PyO3
bindings were added). Switch to dynamic = ["version"] so maturin sources
the version from Cargo.toml [package] version and the two can no longer
diverge. No workflow auto-publishes the Python package, so this is metadata
hygiene rather than a release-path fix.

Co-Authored-By: Claude Fable 5 <noreply@anthropic.com>

---------

Co-authored-by: Claude Fable 5 <noreply@anthropic.com>
This commit is contained in:
Abimael Martell
2026-07-09 12:44:32 -07:00
committed by GitHub
co-authored by Claude Fable 5
parent b375d6f102
commit 6e5e5849c8
7 changed files with 359 additions and 6 deletions
+1 -1
View File
@@ -1,6 +1,6 @@
[package] [package]
name = "pdf-inspector" name = "pdf-inspector"
version = "0.1.3" version = "0.1.4"
edition = "2021" edition = "2021"
autobins = false autobins = false
authors = ["Firecrawl Team"] authors = ["Firecrawl Team"]
+1 -1
View File
@@ -830,7 +830,7 @@ checksum = "384b8ab6d37215f3c5301a95a4accb5d64aa607f1fcb26a11b5303878451b4fe"
[[package]] [[package]]
name = "pdf-inspector" name = "pdf-inspector"
version = "0.1.3" version = "0.1.4"
dependencies = [ dependencies = [
"env_logger", "env_logger",
"log", "log",
+1 -1
View File
@@ -1,6 +1,6 @@
{ {
"name": "@firecrawl/pdf-inspector", "name": "@firecrawl/pdf-inspector",
"version": "1.9.10", "version": "1.9.11",
"description": "Fast PDF classification and text extraction. Detect text-based vs scanned PDFs, extract text by region with quality checks. Native Rust performance via napi-rs.", "description": "Fast PDF classification and text extraction. Detect text-based vs scanned PDFs, extract text by region with quality checks. Native Rust performance via napi-rs.",
"main": "index.js", "main": "index.js",
"types": "index.d.ts", "types": "index.d.ts",
+3 -1
View File
@@ -4,7 +4,9 @@ build-backend = "maturin"
[project] [project]
name = "pdf-inspector" name = "pdf-inspector"
version = "0.1.0" # Version is sourced from Cargo.toml [package] version by maturin so the Python
# artifact always tracks the crate release instead of drifting on its own.
dynamic = ["version"]
description = "Fast PDF inspection, classification, and text extraction with smart scanned vs text-based detection" description = "Fast PDF inspection, classification, and text extraction with smart scanned vs text-based detection"
license = { text = "MIT" } license = { text = "MIT" }
requires-python = ">=3.8" requires-python = ">=3.8"
+327 -2
View File
@@ -3697,7 +3697,14 @@ fn detect_encoding_issues(markdown: &str) -> bool {
} }
// Heuristic 2: dollar-as-space pattern // Heuristic 2: dollar-as-space pattern
has_dollar_as_space_pattern(markdown) if has_dollar_as_space_pattern(markdown) {
return true;
}
// Heuristic 3: substitution-cipher letter statistics (broken ToUnicode)
let mut stats = CipherGarbleStats::default();
stats.add_text(markdown);
stats.looks_garbled()
} }
fn has_dollar_as_space_pattern(markdown: &str) -> bool { fn has_dollar_as_space_pattern(markdown: &str) -> bool {
@@ -3721,6 +3728,156 @@ fn has_dollar_as_space_pattern(markdown: &str) -> bool {
false false
} }
/// English letter frequencies (percent, az). Used as a natural-language
/// reference: every Latin-script language in the eval corpus (Swedish,
/// Finnish, Turkish, German, romaji) scores ≥ 0.80 cosine similarity against
/// it, while substitution-cipher text scores ~0.53.
const ENGLISH_LETTER_FREQ: [f64; 26] = [
8.2, 1.5, 2.8, 4.3, 12.7, 2.2, 2.0, 6.1, 7.0, 0.15, 0.8, 4.0, 2.4, 6.7, 7.5, 1.9, 0.1, 6.0,
6.3, 9.1, 2.8, 1.0, 2.4, 0.15, 2.0, 0.07,
];
/// Letter statistics for detecting substitution-cipher garbling: broken
/// ToUnicode CMaps that shift every character by a per-range constant (e.g.
/// `Certificate` extracted as `8VceZWZTReV`). Such text is 100% printable
/// ASCII with word-like token lengths, so it defeats `is_garbage_text` and
/// produces no replacement characters — it needs its own discriminator.
#[derive(Debug, Default)]
struct CipherGarbleStats {
/// Case-folded ASCII letter histogram.
letter_counts: [u32; 26],
ascii_letters: usize,
ascii_vowels: usize,
/// Accented Latin letters (Latin-1 Supplement through Latin Extended-B,
/// plus Latin Extended Additional). Count toward Latin dominance only.
latin_ext_letters: usize,
non_latin_letters: usize,
/// Adjacent ASCII-letter pairs, and how many of them switch from
/// lowercase straight to uppercase mid-word.
letter_bigrams: usize,
case_shift_bigrams: usize,
}
impl CipherGarbleStats {
fn add_text(&mut self, text: &str) {
let mut prev: Option<char> = None;
for ch in text.chars() {
if ch.is_ascii_alphabetic() {
let idx = (ch.to_ascii_lowercase() as u8 - b'a') as usize;
self.letter_counts[idx] += 1;
self.ascii_letters += 1;
if matches!(ch.to_ascii_lowercase(), 'a' | 'e' | 'i' | 'o' | 'u') {
self.ascii_vowels += 1;
}
if let Some(p) = prev {
self.letter_bigrams += 1;
if p.is_ascii_lowercase() && ch.is_ascii_uppercase() {
self.case_shift_bigrams += 1;
}
}
prev = Some(ch);
} else {
if ch.is_alphabetic() {
if matches!(ch as u32, 0xC0..=0x24F | 0x1E00..=0x1EFF) {
self.latin_ext_letters += 1;
} else {
self.non_latin_letters += 1;
}
}
prev = None;
}
}
}
/// Cosine similarity between the observed letter histogram and English
/// letter frequencies. A shifted alphabet permutes the histogram, which
/// destroys the similarity regardless of the shift amount.
fn english_cosine(&self) -> f64 {
if self.ascii_letters == 0 {
return 1.0;
}
let n = self.ascii_letters as f64;
let mut dot = 0.0;
let mut norm_obs = 0.0;
for (count, freq) in self.letter_counts.iter().zip(ENGLISH_LETTER_FREQ) {
let p = *count as f64 / n;
dot += p * freq;
norm_obs += p * p;
}
let norm_en = ENGLISH_LETTER_FREQ
.iter()
.map(|f| f * f)
.sum::<f64>()
.sqrt();
dot / (norm_obs.sqrt() * norm_en)
}
/// Cosine similarity between the observed histogram and English
/// frequencies after sorting BOTH descending — i.e. comparing the *shape*
/// of the frequency profile, ignoring which letter sits where. A
/// substitution cipher is a bijection, so it preserves this shape exactly
/// (att10k 0.97, arbitrary shifts 0.99) regardless of case or offset.
/// Non-linguistic ASCII has a different profile: a small alphabet is far
/// steeper (random DNA 0.74, hex dumps 0.81), so the shape diverges.
fn english_shape_cosine(&self) -> f64 {
if self.ascii_letters == 0 {
return 1.0;
}
let n = self.ascii_letters as f64;
let mut obs: [f64; 26] = std::array::from_fn(|i| self.letter_counts[i] as f64 / n);
obs.sort_unstable_by(|a, b| b.total_cmp(a));
let mut en = ENGLISH_LETTER_FREQ;
en.sort_unstable_by(|a, b| b.total_cmp(a));
let dot: f64 = obs.iter().zip(en).map(|(o, e)| o * e).sum();
let norm_obs = obs.iter().map(|o| o * o).sum::<f64>().sqrt();
let norm_en = en.iter().map(|e| e * e).sum::<f64>().sqrt();
dot / (norm_obs * norm_en)
}
/// Thresholds validated against the 380-document pdf-evals snapshot
/// corpus (0 false positives) and the garbled ParseBench `att10k` page
/// (vowel ratio 0.245, case-shift rate 0.225, cosine 0.532). Closest
/// legitimate document on each axis: vowel ratio 0.264 (circuit
/// schematic), case-shift rate 0.021, cosine 0.801.
fn looks_garbled(&self) -> bool {
// Need a statistically meaningful, Latin-dominant sample.
if self.ascii_letters < 200
|| self.non_latin_letters > self.ascii_letters + self.latin_ext_letters
{
return false;
}
// Real Latin-script text keeps vowels above ~30% of letters even in
// acronym- and part-number-heavy documents; shifted text starves them.
let vowel_ratio = self.ascii_vowels as f64 / self.ascii_letters as f64;
if vowel_ratio > 0.30 {
return false;
}
// Signal 1: lowercase→uppercase transitions inside words. A shifted
// lowercase alphabet straddles the ASCII uppercase block ('i'→'Z',
// 't'→'e'), so garbled words flip case constantly. Real documents
// stay ≤ 0.02 even with camelCase identifiers.
let case_shifts = self.letter_bigrams >= 100
&& self.case_shift_bigrams as f64 >= self.letter_bigrams as f64 * 0.10;
// Signal 2: the histogram is a permutation of natural language — an
// English-like frequency SHAPE (sorted cosine high) but with letters
// in the wrong POSITIONS (unsorted cosine low). This is the signature
// of a substitution cipher and is case-independent, so it catches
// all-lowercase and all-uppercase shifts as well as case-straddling
// ones. Genuinely non-linguistic ASCII that is merely "unlike English"
// fails one of the two halves: DNA/hex dumps have too steep a profile
// (shape cosine < 0.90), while protein sequences, ticker symbols and
// base64 are not sufficiently unlike English in position (unsorted
// cosine ≥ 0.60) — so none of them are routed to OCR.
let permuted_language = self.english_cosine() < 0.60 && self.english_shape_cosine() >= 0.90;
case_shifts || permuted_language
}
}
#[derive(Debug, Default)] #[derive(Debug, Default)]
struct TextQualityReport { struct TextQualityReport {
pages_needing_ocr: Vec<u32>, pages_needing_ocr: Vec<u32>,
@@ -3734,6 +3891,7 @@ struct PageTextQualityEvidence {
replacement_chars: usize, replacement_chars: usize,
replacement_spans: usize, replacement_spans: usize,
longest_replacement_run: usize, longest_replacement_run: usize,
cipher_garble: CipherGarbleStats,
} }
#[derive(Debug, Clone, Copy, PartialEq, Eq)] #[derive(Debug, Clone, Copy, PartialEq, Eq)]
@@ -3753,6 +3911,7 @@ fn analyze_text_quality(items: &[TextItem]) -> TextQualityReport {
let evidence = evidence_by_page.entry(item.page).or_default(); let evidence = evidence_by_page.entry(item.page).or_default();
evidence.chars += item.text.chars().filter(|ch| !ch.is_whitespace()).count(); evidence.chars += item.text.chars().filter(|ch| !ch.is_whitespace()).count();
evidence.cipher_garble.add_text(&item.text);
match text_span_decoding_issue_kind(&item.text) { match text_span_decoding_issue_kind(&item.text) {
Some(TextSpanIssueKind::Strong) => { Some(TextSpanIssueKind::Strong) => {
@@ -3776,7 +3935,8 @@ fn analyze_text_quality(items: &[TextItem]) -> TextQualityReport {
if reasons_by_page.contains_key(&page) { if reasons_by_page.contains_key(&page) {
continue; continue;
} }
if page_replacement_evidence_needs_ocr(&evidence) { if page_replacement_evidence_needs_ocr(&evidence) || evidence.cipher_garble.looks_garbled()
{
add_ocr_reason( add_ocr_reason(
&mut reasons_by_page, &mut reasons_by_page,
page, page,
@@ -5965,6 +6125,171 @@ mod tests {
assert!(!detect_encoding_issues(text)); assert!(!detect_encoding_issues(text));
} }
/// Real garbled output from ParseBench `text_simple__att10k.pdf`: a broken
/// ToUnicode CMap shifts every character by a per-range constant, so
/// "Certificate of Designations with respect to Series C" extracts as
/// pure-ASCII ciphertext (issue #118).
const SHIFTED_CIPHER_TEXT: &str =
"8VceZWZTReVW9VdZXReZdhZeYcVdaVTeeHVcZVd8EcVWVccVUHeT:iYZSZe-(,e2'WZ]V \
;VScfRcj2&,*,*$ .'R CZdecfVehYZTYUVWZVdeYVcZXYedWY]UVcdW]X'eVcUVSeYVcVXZdecReRUR]]ed \
TCBGC@ZUReVUdfSdZUZRcZVdZdWZ]VUYVcVhZeYafcdfReeVXf]ReZV0*S$.$ZZZ$6$&ViTVae \
WceYVZdecfVedcVWVccVUe.'S&.'T&.'U&.'V&.'WSV]h(EfcdfReeYZdcVXf]ReZYV \
cVXZdecReYVcVSjRXcVVdeWfcZdYRTajWRjdfTYZdecfVeWZ]VUYVcVhZeYeYVH:8 \
cVbfVde( .'S fRcRejWTVceRZZXReZTZWZT7V]]IV]VaYV8(RUHfeYhVdeVc7V]]IV]VaYV8 \
:iYZSZe.'TeYVaVcZUVUZX9VTVSVc-&,*$";
#[test]
fn test_detect_encoding_issues_shifted_cipher_text() {
assert!(detect_encoding_issues(SHIFTED_CIPHER_TEXT));
}
#[test]
fn test_shifted_cipher_below_sample_threshold_not_flagged() {
// Fewer than 200 ASCII letters: not enough evidence to condemn.
assert!(!detect_encoding_issues("8VceZWZTReVW9VdZXReZdhZeY"));
}
#[test]
fn test_clean_prose_not_flagged_as_cipher() {
let prose = "Certificate of Designations with respect to Series C Preferred Stock, \
filed February 18, 2020. No instrument which defines the rights of holders of \
long-term debt of the registrant and all of its consolidated subsidiaries is \
filed herewith pursuant to Regulation S-K, Item 601. Pursuant to this regulation, \
the registrant hereby agrees to furnish a copy of any such instrument to the SEC \
upon request.";
assert!(!detect_encoding_issues(prose));
}
#[test]
fn test_camel_case_code_not_flagged_as_cipher() {
let code = "The getElementById and querySelectorAll methods return DOM nodes. Use \
addEventListener with removeEventListener, requestAnimationFrame with \
cancelAnimationFrame, and setTimeout with clearTimeout. The XMLHttpRequest \
object exposes onreadystatechange, responseText and getAllResponseHeaders. \
Prefer createElement, appendChild, insertBefore and replaceChild for DOM \
manipulation, and getBoundingClientRect for layout measurement.";
assert!(!detect_encoding_issues(code));
}
#[test]
fn test_accented_european_text_not_flagged_as_cipher() {
let swedish = "Regeringen föreslår att riksdagen antar förslaget till lag om ändring \
i skatteförfarandelagen. Bestämmelserna föreslås träda i kraft den första januari. \
Förslaget innebär att företag med säte i utlandet måste lämna särskilda uppgifter \
till Skatteverket varje kvartal, och att avgiften höjs för överträdelser av de nya \
bestämmelserna om rapporteringsskyldighet för gränsöverskridande arrangemang.";
assert!(!detect_encoding_issues(swedish));
}
#[test]
fn test_all_caps_text_not_flagged_as_cipher() {
let caps = "EXHIBIT INDEX PURSUANT TO ITEM 601 OF REGULATION SK CERTIFICATE OF \
DESIGNATIONS WITH RESPECT TO SERIES C PREFERRED STOCK FILED FEBRUARY EIGHTEEN \
TWENTY TWENTY AND INCORPORATED HEREIN BY REFERENCE TO THE ANNUAL REPORT ON FORM \
TENK FOR THE PERIOD ENDED DECEMBER THIRTYFIRST TWENTY NINETEEN AS AMENDED";
assert!(!detect_encoding_issues(caps));
}
// A Caesar shift of prose that stays within a single case block does not
// trigger the case-shift signal, but it permutes the letter histogram: the
// frequency SHAPE stays English-like while letter POSITIONS scramble, so
// the permutation signal catches it regardless of case.
const CAESAR_PROSE: &str =
"The registrant hereby agrees to furnish a copy of any such instrument to the \
Commission upon request. This certificate of designations was filed February with \
respect to Series Preferred Stock and incorporated herein by reference to the annual \
report on form for the period ended December as amended and restated thereafter.";
fn caesar_shift(text: &str, k: u8) -> String {
text.chars()
.map(|c| match c {
'a'..='z' => (((c as u8 - b'a' + k) % 26) + b'a') as char,
'A'..='Z' => (((c as u8 - b'A' + k) % 26) + b'A') as char,
_ => c,
})
.collect()
}
#[test]
fn test_mixed_case_caesar_shift_flagged() {
assert!(detect_encoding_issues(&caesar_shift(CAESAR_PROSE, 3)));
}
#[test]
fn test_all_lowercase_caesar_shift_flagged() {
// Uniform all-lowercase garbled prose: the earlier mixed-case guard
// would have exempted this, so it must be caught by the case-agnostic
// permutation signal instead.
assert!(detect_encoding_issues(&caesar_shift(
&CAESAR_PROSE.to_lowercase(),
5
)));
}
#[test]
fn test_all_uppercase_caesar_shift_flagged() {
assert!(detect_encoding_issues(&caesar_shift(
&CAESAR_PROSE.to_uppercase(),
7
)));
}
#[test]
fn test_dna_sequence_not_flagged_as_cipher() {
// Non-linguistic ASCII: unlike English (low vowel ratio, low cosine)
// but not garbled. Its 4-letter alphabet makes the frequency profile
// too steep, so the shape cosine falls below the permutation threshold.
let dna = "ACGT".repeat(120);
assert!(!detect_encoding_issues(&dna));
}
#[test]
fn test_protein_sequence_not_flagged_as_cipher() {
let protein =
"MKTAYIAKQRQISFVKSHFSRQLEERLGLIEVQAPILSRVGDGTQDNLSGAEKAVQVKVKALPDAQFEVVHSLAKWKR"
.repeat(6);
assert!(!detect_encoding_issues(&protein));
}
#[test]
fn test_ticker_list_not_flagged_as_cipher() {
let tickers = "AAPL MSFT GOOG TSLA NVDA AMZN META NFLX AMD INTC CSCO ORCL CRM ADBE QCOM \
TXN AVGO MU LRCX KLAC ASML SNPS CDNS FTNT PANW "
.repeat(4);
assert!(!detect_encoding_issues(&tickers));
}
#[test]
fn test_text_quality_flags_shifted_cipher_page() {
let items = vec![
test_text_item_on_page(1, SHIFTED_CIPHER_TEXT),
test_text_item_on_page(2, "A clean second page should not be routed to OCR."),
];
let quality = analyze_text_quality(&items);
assert!(quality.has_encoding_issues);
assert_eq!(quality.pages_needing_ocr, vec![1]);
assert_eq!(
quality.reasons_by_page.get(&1).cloned(),
Some(vec![OCR_REASON_SUSPECTED_GARBLED_TEXT.to_string()])
);
}
#[test]
fn test_text_quality_cipher_stats_accumulate_across_items() {
// The garbled page arrives as many short spans; no single span has
// enough letters to flag on its own.
let items: Vec<TextItem> = SHIFTED_CIPHER_TEXT
.split_whitespace()
.map(|chunk| test_text_item_on_page(1, chunk))
.collect();
let quality = analyze_text_quality(&items);
assert_eq!(quality.pages_needing_ocr, vec![1]);
}
#[test] #[test]
fn test_text_quality_flags_localized_cid_mojibake_span() { fn test_text_quality_flags_localized_cid_mojibake_span() {
let items = vec![ let items = vec![
Binary file not shown.
+26
View File
@@ -1356,6 +1356,32 @@ fn test_extract_regions_mem_identity_h_needs_ocr() {
); );
} }
/// ParseBench `text_simple__att10k.pdf` (issue #118): the producer authored a
/// broken ToUnicode CMap that shifts every character by a per-range constant,
/// and the embedded subset font has no `cmap` table to recover from. The
/// resulting ciphertext is 100% printable ASCII, so it must be caught by the
/// substitution-cipher statistics and routed to OCR instead of served silently.
#[test]
fn test_extract_pages_mem_shifted_cipher_tounicode_needs_ocr() {
let buf = std::fs::read("tests/fixtures/shifted_cipher_tounicode.pdf").unwrap();
let result = extract_pages_markdown_mem(&buf, None).unwrap();
assert_eq!(result.pages.len(), 1);
assert!(
result.pages[0].needs_ocr,
"shifted-cipher garbled page should be flagged needs_ocr"
);
assert!(
result.pages[0].markdown.is_empty(),
"garbled markdown should be suppressed"
);
assert_eq!(result.pages_needing_ocr, vec![1]);
assert_eq!(
result.pages[0].ocr_reason.as_deref(),
Some("suspected_garbled_text")
);
}
#[test] #[test]
fn test_extract_regions_mem_multiple_regions_per_page() { fn test_extract_regions_mem_multiple_regions_per_page() {
let buf = std::fs::read("tests/fixtures/nexo-price-en.pdf").unwrap(); let buf = std::fs::read("tests/fixtures/nexo-price-en.pdf").unwrap();