Compare commits

...
Author SHA1 Message Date
Abimael MartellandClaude Fable 5 9ab6e52eb3 fix(fonts): recognize URW -Medi suffix as bold
URW Type 1 fonts abbreviate the Medium weight as "Medi" in the font
name (NimbusRomNo9L-Medi is the Times-Bold substitute embedded by most
LaTeX toolchains; -MediItal is bold italic). is_bold_font only matched
the full word "medium", so bold ran undetected across LaTeX-produced
PDFs — dropping ** emphasis and starving bold-based heading detection
of its signal.

Co-Authored-By: Claude Fable 5 <noreply@anthropic.com>
2026-07-10 18:12:36 -07:00
Abimael MartellandClaude Fable 5 b4d401241e chore(napi): bump @firecrawl/pdf-inspector to 1.10.0 (#127)
New in this release (#125): isStrikeout on TextItem (geometric
detection sharing the underline rules pipeline), descriptor/embedded-
font bold+italic recall for subset fonts (FontDescriptor flags,
ttf-parser OS/2+post, bare-CFF Name INDEX), quote-operator advance
width, Ts text-rise handling, ActualText rise/position fixes, and a
document-scoped font style cache.


Claude-Session: https://claude.ai/code/session_01L3U6BKYCS73DVA83odAfYB

Co-authored-by: Claude Fable 5 <noreply@anthropic.com>
2026-07-10 17:41:46 -07:00
Abimael MartellandClaude Fable 5 57335f8bcf feat(extractor): descriptor/embedded-font style flags + geometric strikeout detection (#125)
* feat(extractor): descriptor/embedded-font style flags + geometric strikeout detection

Two style-recall gaps, both invisible to the existing name-based
heuristics:

1. Subset fonts with opaque BaseFont names ("Tc1", "AAAAAB+Amplitude")
   defeat is_italic_font/is_bold_font. New descriptor_style_flags reads
   the FontDescriptor (ItalicAngle beyond 4 degrees, Flags bit 7 Italic,
   bit 19 ForceBold) and, when the descriptor claims upright, falls back
   to the embedded font file: ttf-parser's OS/2 fsSelection + post
   italicAngle for sfnt fonts, and the CFF Name INDEX PostScript name
   for bare-CFF FontFile3 (descriptor rewritten to ItalicAngle 0 while
   embedding "Amplitude-LightItalic" was observed in the wild).
   ORed into is_bold/is_italic at item creation (content streams and
   form XObjects).

2. No strikeout signal existed. New is_strikeout on TextItem, detected
   in the same pass as underline: same rules pipeline (stroked lines /
   thin filled rects, table-ruling suppression), different vertical
   window — a rule crossing the glyphs at 12-55% of the em above the
   baseline instead of sitting at it. Exposed through napi and python
   bindings and pdf2md --items-json.

Verified on public ParseBench corpus docs: previously-missed italic
council titles and bold CJK itinerary headings now flagged (render-
checked); 24/508 docs gain flags, none lose any; 35 strikeout items
detected corpus-wide, disjoint from underline.

Co-Authored-By: Claude Fable 5 <noreply@anthropic.com>
Claude-Session: https://claude.ai/code/session_01L3U6BKYCS73DVA83odAfYB

* fix(review): quote-op advance width, Ts text rise, doc-level font style cache (PR #125 review)

Address three valid findings from review:

- The ' (move-to-next-line-and-show-text) operator emitted zero-width
  items and never advanced the text matrix, so geometric underline/
  strikeout detection (which requires width > 0) could never mark its
  text, and following show ops overlapped it. Reuse Tj's advance-width
  computation and matrix advance.

- Ts (text rise) was dropped entirely: raised/lowered runs kept the
  unshifted baseline, so rules drawn at the risen glyph position missed
  the strike/underline windows. Track rise in the text state (saved and
  restored with q/Q) and shift the rendering position through the text
  matrix's y column; advances stay on the unshifted matrix per spec.

- descriptor_style_flags re-decompressed and re-parsed the same embedded
  font program on every page whenever the descriptor left a style flag
  unset (the common case). Add a document-scoped FontStyleCache keyed by
  the FontFile2/FontFile3 object id, threaded through page and form
  extraction alongside the existing CMapDecisionCache.

The fourth finding (Form XObject rules never reach geometric detection)
is real but pre-existing for underline and needs the form walker to grow
path/paint tracking plus a new return type; deferred as a follow-up.

Co-Authored-By: Claude Fable 5 <noreply@anthropic.com>
Claude-Session: https://claude.ai/code/session_01L3U6BKYCS73DVA83odAfYB

* fix(review): ActualText items render at their glyphs' text rise (PR #125 review)

The EMC-built ActualText item used the captured text matrix without the
rise adjustment the ordinary Tj/TJ/' emission sites apply, so a tagged
run shown with Ts landed on the unshifted baseline — off the strikeout/
underline windows and inconsistent with untagged runs. The rise is
captured together with the first-glyph matrix (and at BDC for the
entry-position fallback): the item must render at the rise of its
GLYPHS, not whatever rise is set by EMC time.

Co-Authored-By: Claude Fable 5 <noreply@anthropic.com>
Claude-Session: https://claude.ai/code/session_01L3U6BKYCS73DVA83odAfYB

* fix(review): capture ActualText glyph position after the quote op's line move (PR #125 review)

The `'` handler skipped the entire suppressed-extraction block, so a
tagged span whose show op is `'` never captured its glyph matrix/rise —
the EMC item fell back to the BDC-entry matrix, which sits on the
PREVIOUS line (the `'` line move happens after BDC) with no rise. The
capture now happens right after the line move, matching the Tj/TJ
paths.

Co-Authored-By: Claude Fable 5 <noreply@anthropic.com>
Claude-Session: https://claude.ai/code/session_01L3U6BKYCS73DVA83odAfYB

* fix(review): style-boundary gate on subscript merge + strikeout suppression coverage (PR #125 review)

merge_subscript_items absorbed a script digit into its parent
regardless of underline/strikeout flags — dropping the digit's own mark
or widening the parent's over it. The merged item carries one flag, so
differing marks now break the merge, mirroring merge_text_items'
style-boundary rule (pre-existing for underline as well).

Also extends the table-suppression test to assert is_strikeout is
cleared alongside is_underline.

Co-Authored-By: Claude Fable 5 <noreply@anthropic.com>
Claude-Session: https://claude.ai/code/session_01L3U6BKYCS73DVA83odAfYB

---------

Co-authored-by: Claude Fable 5 <noreply@anthropic.com>
2026-07-10 17:30:47 -07:00
Abimael MartellandClaude Fable 5 15bc7894a4 docs: add MIT LICENSE file and license badge (#124)
Cargo.toml and pyproject.toml already declare MIT but the repo had no
LICENSE file, so GitHub and package registries couldn't display it.

Co-authored-by: Claude Fable 5 <noreply@anthropic.com>
2026-07-10 14:25:08 -07:00
Abimael MartellandClaude Fable 5 6e5e5849c8 Detect substitution-cipher garbled text from broken ToUnicode CMaps (#120)
* fix(lib): detect substitution-cipher garbled text from broken ToUnicode CMaps

ParseBench text_simple__att10k.pdf (issue #118) ships Type0/Identity-H
fonts whose ToUnicode CMaps are authored garbled: every bfrange maps with
a wrong constant delta, so text extracts as pure-ASCII ciphertext
("Certificate" -> "8VceZWZTReV"). The embedded subset font has no cmap
table and no glyph names, so no decode source can recover the real text
(poppler and mupdf emit the same ciphertext). The only correct behavior
is to flag the page for OCR instead of serving the garbage silently --
but the text is 100% printable ASCII with word-like tokens, so it slipped
past is_garbage_text and detect_encoding_issues.

Add CipherGarbleStats, a letter-statistics discriminator that flags a
Latin-dominant sample (>=200 ASCII letters) when vowels are starved
(<=30% of letters) AND either:
- lowercase->uppercase transitions inside words exceed 10% of letter
  bigrams (a shifted lowercase alphabet straddles the ASCII uppercase
  block), or
- the letter histogram's cosine similarity against English letter
  frequencies drops below 0.60 (catches shifts that stay within case
  blocks).

Wired into analyze_text_quality (per-page, item-level) and
detect_encoding_issues (markdown-level), so extract_pages_markdown
reports needs_ocr + suspected_garbled_text and suppresses the garbage.

Thresholds validated against the 380-document pdf-evals snapshot corpus
(Swedish, Finnish, Turkish, German, romaji, schematics, all-caps and
camelCase-heavy docs): zero false positives, and byte-identical eval
output vs main. Garbled page measures vowel ratio 0.245 / case-shift
rate 0.225 / cosine 0.532; closest legitimate document on each axis is
0.264 / 0.021 / 0.801.

Fixes #118

Co-Authored-By: Claude Fable 5 <noreply@anthropic.com>

* chore: bump pdf-inspector to 0.1.4, npm package to 1.9.11

Co-Authored-By: Claude Fable 5 <noreply@anthropic.com>

* fix(lib): exempt uniform-case structured content from cipher detection

Address PR review (cubic P2): the frequency branch (english_cosine < 0.60)
fired on any Latin-dominant, low-vowel letter distribution unlike English,
so non-linguistic ASCII — DNA/protein sequences, ticker symbols, hex dumps —
could be suppressed and routed to OCR despite not being garbled. Measured:
DNA cosine 0.428 / vowel ratio 0.260, protein 0.738, tickers 0.747, hex
0.549 — all would have flagged.

Add a mixed-case guard to looks_garbled: garbled English is a permutation of
natural language and carries sentence capitalization (block-straddling shifts
invert the ratio — att10k is 60% uppercase; in-case Caesar shifts preserve it
at ~3%), so both keep some of each case. The exempted structured content is
uniform case (all upper or all lower). Requiring the minority case to be >=1%
of ASCII letters exempts single-case sequences while preserving both garble
signals, including the in-case-shift scenario the frequency branch exists for.

Strictly tightens the detector: it can only remove flags, so the eval corpus
stays at zero false positives (verified byte-identical to a baseline main
binary across all 185 PDFs) and att10k remains flagged. Adds regression tests
for DNA, protein, tickers, and an in-case Caesar shift.

Co-Authored-By: Claude Fable 5 <noreply@anthropic.com>

* fix(lib): make cipher detection case-agnostic via sorted-histogram shape

Address PR review follow-up: the mixed-case guard from the previous commit
returned before the vowel/frequency checks, creating a blind spot — a
uniform-case (all-lower or all-upper) substitution cipher is a plausible
broken-CMap output and would bypass OCR entirely.

Replace the case proxy with the actual invariant. A substitution cipher is
a bijection over a real language's alphabet, so it preserves the frequency
SHAPE (the sorted histogram) while scrambling letter POSITIONS (the unsorted
histogram). Signal 2 now flags when english_cosine < 0.60 (positions unlike
English) AND english_shape_cosine >= 0.90 (profile is still English-shaped).
This is independent of case, so it catches all-lower, all-upper, and
case-straddling shifts alike.

The exempted structured content fails one half: DNA/hex dumps have too steep
a profile (shape cosine 0.74 / 0.81 < 0.90), while protein sequences, ticker
symbols and base64 are not sufficiently unlike English in position (unsorted
cosine 0.74 / 0.75 / 0.77 >= 0.60). All stay out of OCR.

Still strictly corpus-safe: every real Latin document scores unsorted cosine
>= 0.70 (min 0.80), far above the 0.60 gate, so none can reach Signal 2.
Re-verified byte-identical to a baseline main binary across all 185 eval
PDFs; att10k remains flagged. Drops the now-unused case counters and adds
all-lowercase / all-uppercase shifted-prose regression tests.

Co-Authored-By: Claude Fable 5 <noreply@anthropic.com>

* chore: source Python package version from Cargo.toml via maturin

Address PR review (cubic P2): pyproject.toml pinned version = "0.1.0",
which overrides Cargo.toml, so a maturin build produced a 0.1.0 Python
artifact regardless of the crate version (it had drifted since the PyO3
bindings were added). Switch to dynamic = ["version"] so maturin sources
the version from Cargo.toml [package] version and the two can no longer
diverge. No workflow auto-publishes the Python package, so this is metadata
hygiene rather than a release-path fix.

Co-Authored-By: Claude Fable 5 <noreply@anthropic.com>

---------

Co-authored-by: Claude Fable 5 <noreply@anthropic.com>
2026-07-09 12:44:32 -07:00
Abimael MartellandCursor b375d6f102 feat(markdown): underline emission, Unicode scripts, style-preserving merges (#117)
* feat(markdown): underline emission, Unicode scripts, style-preserving merges (ENG-5015 2b)

Three formatting losses in the direct-extraction markdown path:

1. text_with_formatting gains <u> run emission (detect_underline option,
   default on) using the geometric is_underline flag from 1.9.9.
   Underline runs stay free of nested bold/italic markers — consumers
   match tag content literally. Heading lines keep plain text for
   bold/italic but preserve <u>: the tag carries meaning `#` doesn't.
2. merge_subscript_items now maps absorbed digit scripts to Unicode
   sub/superscript forms with direction from the baseline offset
   ("H"+"2" -> "H₂", "word"+raised "2" -> "word²", "m"+"3" -> "m³").
   NFKC/NFKD folds these back to plain digits so text matching
   downstream is unaffected; renderers keep the script semantics.
3. merge_text_items no longer merges across bold/italic boundaries —
   absorbing a styled run into a plain neighbor erased the styling
   before markdown emission ever saw it. On eval docs this recovers
   20-82 italic runs per document that previously emitted as plain.

Snapshots regenerated (diffs are the features: CCl₂F₂, m³, underlined
legal section headings, finer bold runs). pdf-evals regression suite:
202/202 real PDFs pass. napi 1.9.9 -> 1.9.10.

Co-authored-by: Cursor <cursoragent@cursor.com>

* fix(extractor): break merges at underline boundaries too (review)

OR-merging underline stretched the eventual <u> span over neighboring
plain fragments. Merge runs now break on any style-flag change, the
redundant accumulator is gone, and format_list_item learned to move
bullet markers outside <u> wrappers so fully-underlined bullet lines
still render as markdown lists. td9264 snapshot regenerated — spans are
tighter (trailing periods correctly outside the tag).

Co-authored-by: Cursor <cursoragent@cursor.com>

* fix(markdown): strip stray spaces before sentence punctuation (review)

Style-boundary item splits can strand a trailing period in its own
fragment, and multiple assembly paths join fragments with spaces,
yielding "word ." artifacts. Rather than chasing every join site, a
postprocess pass removes a space before `.`/`,`/`;` when the mark ends
its token (whitespace, cell boundary `|`, or end of text follows).
Dot leaders/ellipses and mid-token periods are untouched.

Fixes the td9264 "companies ." artifacts and two pre-existing
"armoring ," artifacts in the 2013-app2 snapshot. pdf-evals: zero
markdown diffs across all 203 corpus PDFs vs committed baselines.

Co-authored-by: Cursor <cursoragent@cursor.com>

* fix(tables): trim spaces inside parenthetical cell fragments

* fix(tables): reject sparse prose row-stripe tables

---------

Co-authored-by: Cursor <cursoragent@cursor.com>
2026-07-08 23:40:08 -07:00
Abimael MartellandCursor 422a2ff118 feat(extractor): geometric underline detection on TextItem (#116)
* feat(extractor): geometric underline detection on TextItem (ENG-5015)

PDFs carry no underline font flag — underlines are stroked horizontal
lines or thin filled rects drawn under the baseline. Correlate those
graphics (already parsed from the content stream) with text items in a
post-pass: a rule within ~0.35em below the baseline covering >=60% of
an item's width marks is_underline.

Exposed through the napi and python bindings. Verified on real docs:
4/4 underlined sentences flagged on a Japanese report, links/headings
flagged on 8 of 10 underline-bearing eval docs, zero flags on docs
without underlines. Known FP source (table cell borders) documented —
downstream applies inline styling only to plain-text regions.

napi 1.9.8 -> 1.9.9.

Co-authored-by: Cursor <cursoragent@cursor.com>

* fix(extractor): underline rules only from painted rects, normalized extents (review)

Two review fixes: (1) normalize rect extents before the thickness/width
checks — `re` operands pass through the CTM so width/height can be
negative, which missed negative-width rules and let negative-height
bands pass as thin; (2) only feed painted rects to underline detection —
`re` rects now wait in a pending list until a paint operator (S/s, f/F/
f*, B/B*/b/b*) confirms them, and `re W n` clip-only paths are discarded
at `n`, so invisible clip boundaries no longer underline nearby text.
Marking moved into content_stream where paint state lives (pre-rotation,
consistent device space).

Co-authored-by: Cursor <cursoragent@cursor.com>

* fix(extractor): harden underline detection

* feat(cli): export positioned text item json

---------

Co-authored-by: Cursor <cursoragent@cursor.com>
2026-07-08 10:20:18 -07:00
39 changed files with 2549 additions and 112 deletions
+1 -1
View File
@@ -1,6 +1,6 @@
[package]
name = "pdf-inspector"
version = "0.1.3"
version = "0.1.4"
edition = "2021"
autobins = false
authors = ["Firecrawl Team"]
+21
View File
@@ -0,0 +1,21 @@
MIT License
Copyright (c) 2026 Firecrawl
Permission is hereby granted, free of charge, to any person obtaining a copy
of this software and associated documentation files (the "Software"), to deal
in the Software without restriction, including without limitation the rights
to use, copy, modify, merge, publish, distribute, sublicense, and/or sell
copies of the Software, and to permit persons to whom the Software is
furnished to do so, subject to the following conditions:
The above copyright notice and this permission notice shall be included in all
copies or substantial portions of the Software.
THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR
IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY,
FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE
AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER
LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM,
OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE
SOFTWARE.
+5 -1
View File
@@ -2,6 +2,7 @@
[![Crates.io](https://img.shields.io/crates/v/pdf-inspector.svg)](https://crates.io/crates/pdf-inspector)
[![npm](https://img.shields.io/npm/v/@firecrawl/pdf-inspector.svg)](https://www.npmjs.com/package/@firecrawl/pdf-inspector)
[![License: MIT](https://img.shields.io/badge/license-MIT-blue.svg)](LICENSE)
Fast Rust library for PDF classification and text extraction. Detects whether a PDF is text-based or scanned, extracts text with position awareness, and converts to clean Markdown — all without OCR. Includes bindings for [Python](docs/python.md) and [Node.js](napi/README.md).
@@ -111,6 +112,9 @@ pdf2md document.pdf
# JSON output (for piping)
pdf2md document.pdf --json
# Positioned TextItem JSON, including is_underline metadata
pdf2md document.pdf --items-json
# Raw markdown only (no headers)
pdf2md document.pdf --raw
@@ -239,4 +243,4 @@ See [docs/debugging.md](docs/debugging.md) for `RUST_LOG` environment variable u
## License
MIT
[MIT](LICENSE)
+1 -1
View File
@@ -830,7 +830,7 @@ checksum = "384b8ab6d37215f3c5301a95a4accb5d64aa607f1fcb26a11b5303878451b4fe"
[[package]]
name = "pdf-inspector"
version = "0.1.3"
version = "0.1.4"
dependencies = [
"env_logger",
"log",
+1 -1
View File
@@ -1,6 +1,6 @@
{
"name": "@firecrawl/pdf-inspector",
"version": "1.9.8",
"version": "1.10.0",
"description": "Fast PDF classification and text extraction. Detect text-based vs scanned PDFs, extract text by region with quality checks. Native Rust performance via napi-rs.",
"main": "index.js",
"types": "index.d.ts",
+8
View File
@@ -80,6 +80,12 @@ pub struct TextItem {
pub page: u32,
pub is_bold: bool,
pub is_italic: bool,
/// Underline detected geometrically (drawn rule/thin rect under the
/// baseline) — PDFs carry no underline font flag.
pub is_underline: bool,
/// Strikeout detected geometrically (rule crossing the glyphs at mid
/// x-height).
pub is_strikeout: bool,
pub item_type: ItemType,
/// URL for link items, `None` for other types.
pub link_url: Option<String>,
@@ -290,6 +296,8 @@ pub fn extract_text_with_positions(
page: item.page,
is_bold: item.is_bold,
is_italic: item.is_italic,
is_underline: item.is_underline,
is_strikeout: item.is_strikeout,
item_type,
link_url,
}
+2
View File
@@ -38,6 +38,8 @@ class TextItem:
page: int
is_bold: bool
is_italic: bool
is_underline: bool
is_strikeout: bool
item_type: str
class RegionText:
+3 -1
View File
@@ -4,7 +4,9 @@ build-backend = "maturin"
[project]
name = "pdf-inspector"
version = "0.1.0"
# Version is sourced from Cargo.toml [package] version by maturin so the Python
# artifact always tracks the crate release instead of drifting on its own.
dynamic = ["version"]
description = "Fast PDF inspection, classification, and text extraction with smart scanned vs text-based detection"
license = { text = "MIT" }
requires-python = ">=3.8"
+107 -1
View File
@@ -1,6 +1,10 @@
//! CLI tool for PDF to Markdown conversion
use pdf_inspector::{process_pdf_with_options, LayoutComplexity, PdfOptions, PdfType, ProcessMode};
use pdf_inspector::extractor::ItemType;
use pdf_inspector::{
extract_text_with_positions_pages, process_pdf_with_options, LayoutComplexity, PdfOptions,
PdfType, ProcessMode, TextItem,
};
use std::collections::HashSet;
use std::env;
use std::fmt::Write;
@@ -47,6 +51,94 @@ fn format_ocr_reasons_by_page(reasons: &[pdf_inspector::PageOcrReasons]) -> Stri
.join(",")
}
fn item_type_label(item_type: &ItemType) -> &'static str {
match item_type {
ItemType::Text => "text",
ItemType::Image => "image",
ItemType::Link(_) => "link",
ItemType::FormField => "form_field",
}
}
fn format_items_json(items: &[TextItem]) -> String {
let underlined_count = items.iter().filter(|item| item.is_underline).count();
let items_json = items
.iter()
.map(|item| {
let mcid = item
.mcid
.map(|value| value.to_string())
.unwrap_or_else(|| "null".to_string());
let link_url = match &item.item_type {
ItemType::Link(url) => format!(r#","url":"{}""#, json_escape(url)),
_ => String::new(),
};
format!(
r#"{{"text":"{}","page":{},"x":{:.2},"y":{:.2},"width":{:.2},"height":{:.2},"font":"{}","font_size":{:.2},"is_bold":{},"is_italic":{},"is_underline":{},"is_strikeout":{},"item_type":"{}","mcid":{}{}}}"#,
json_escape(&item.text),
item.page,
item.x,
item.y,
item.width,
item.height,
json_escape(&item.font),
item.font_size,
item.is_bold,
item.is_italic,
item.is_underline,
item.is_strikeout,
item_type_label(&item.item_type),
mcid,
link_url,
)
})
.collect::<Vec<_>>()
.join(",");
format!(
r#"{{"total_items":{},"underlined_count":{},"items":[{}]}}"#,
items.len(),
underlined_count,
items_json
)
}
#[cfg(test)]
mod tests {
use super::format_items_json;
use pdf_inspector::extractor::ItemType;
use pdf_inspector::TextItem;
#[test]
fn items_json_includes_position_and_underline_metadata() {
let items = vec![TextItem {
text: "A \"quoted\" item".to_string(),
x: 12.345,
y: 67.891,
width: 23.456,
height: 9.876,
font: "F1".to_string(),
font_size: 10.0,
page: 2,
is_bold: false,
is_italic: true,
is_underline: true,
is_strikeout: true,
item_type: ItemType::Text,
mcid: Some(7),
}];
let json = format_items_json(&items);
assert!(json.contains(r#""text":"A \"quoted\" item""#));
assert!(json.contains(r#""page":2"#));
assert!(json.contains(r#""x":12.35"#));
assert!(json.contains(r#""is_underline":true"#));
assert!(json.contains(r#""item_type":"text""#));
assert!(json.contains(r#""mcid":7"#));
}
}
/// Parse a page specification like "1,3,5-10,20" into a HashSet of page numbers.
fn parse_page_spec(spec: &str) -> Result<HashSet<u32>, String> {
let mut pages = HashSet::new();
@@ -104,6 +196,7 @@ fn main() {
if args.len() < 2 {
eprintln!("Usage: {} <pdf_file> [output_file]", args[0]);
eprintln!(" {} <pdf_file> --json", args[0]);
eprintln!(" {} <pdf_file> --items-json", args[0]);
eprintln!(" {} <pdf_file> --raw", args[0]);
eprintln!();
eprintln!("Converts PDF to Markdown with smart type detection.");
@@ -111,6 +204,7 @@ fn main() {
eprintln!();
eprintln!("Options:");
eprintln!(" --json Output result as JSON");
eprintln!(" --items-json Output positioned TextItem JSON");
eprintln!(" --raw Output only markdown (no headers)");
eprintln!(" --pages Insert page break markers (<!-- Page N -->)");
eprintln!(" --select-pages N Only process specified pages (e.g. 1,3,5-10)");
@@ -121,6 +215,7 @@ fn main() {
let pdf_path = &args[1];
let json_output = args.iter().any(|a| a == "--json");
let items_json_output = args.iter().any(|a| a == "--items-json");
let raw_output = args.iter().any(|a| a == "--raw");
let page_numbers = args.iter().any(|a| a == "--pages");
let detect_only = args.iter().any(|a| a == "--detect-only");
@@ -145,6 +240,17 @@ fn main() {
})
});
if items_json_output {
match extract_text_with_positions_pages(pdf_path, page_filter.as_ref()) {
Ok(items) => println!("{}", format_items_json(&items)),
Err(e) => {
println!(r#"{{"error":"{}"}}"#, json_escape(&e.to_string()));
process::exit(1);
}
}
return;
}
let output_file = args
.get(2)
.filter(|a| !a.starts_with("--"))
+456 -30
View File
@@ -14,9 +14,11 @@ use lopdf::{Document, Encoding, Object, ObjectId};
use std::collections::HashMap;
use super::fonts::{
build_font_encodings, build_font_widths, compute_string_width_ts, extract_text_from_operand,
get_font_file2_obj_num, get_operand_bytes, CMapDecisionCache,
build_font_encodings, build_font_widths, compute_string_width_ts, descriptor_style_flags,
extract_text_from_operand, get_font_file2_obj_num, get_operand_bytes, CMapDecisionCache,
FontStyleCache,
};
use super::underline::UnderlineLine;
use super::xobjects::{extract_form_xobject_text, get_page_xobjects, XObjectType};
use super::{get_number, image_bbox_from_ctm, multiply_matrices};
@@ -74,6 +76,56 @@ fn strip_pdf_comments(data: &[u8]) -> Vec<u8> {
result
}
fn transform_path_point(x: f32, y: f32, ctm: &[f32; 6]) -> (f32, f32) {
(
x * ctm[0] + y * ctm[2] + ctm[4],
x * ctm[1] + y * ctm[3] + ctm[5],
)
}
fn transformed_stroke_width(
line_width: f32,
ctm: &[f32; 6],
x1: f32,
y1: f32,
x2: f32,
y2: f32,
) -> f32 {
let user_width = line_width.abs();
let dx = x2 - x1;
let dy = y2 - y1;
let len = (dx * dx + dy * dy).sqrt();
if len <= f32::EPSILON {
return user_width;
}
// PDF stroke width scales perpendicular to the path direction.
let nx = -dy / len;
let ny = dx / len;
let ndx = nx * ctm[0] + ny * ctm[2];
let ndy = nx * ctm[1] + ny * ctm[3];
user_width * (ndx * ndx + ndy * ndy).sqrt()
}
/// Text rise (Ts) displaces the glyph origin by (0, rise) in unscaled text
/// space — per the rendering-matrix definition it sits left of Tm, so the
/// offset maps through the text matrix's y column. Rise never contributes
/// to the advance, so callers apply it only to the rendering position and
/// keep advancing the unshifted text matrix.
fn rise_adjusted(tm: &[f32; 6], rise: f32) -> [f32; 6] {
if rise == 0.0 {
return *tm;
}
[
tm[0],
tm[1],
tm[2],
tm[3],
tm[4] + rise * tm[2],
tm[5] + rise * tm[3],
]
}
/// Returns `(page_extraction, has_gid_fonts)` where `has_gid_fonts` indicates
/// the page uses fonts with unresolvable gid-encoded glyphs.
pub(crate) fn extract_page_text_items(
@@ -82,6 +134,7 @@ pub(crate) fn extract_page_text_items(
page_num: u32,
font_cmaps: &FontCMaps,
include_invisible: bool,
style_cache: &mut FontStyleCache,
) -> Result<(PageExtraction, bool, bool), PdfError> {
use lopdf::content::Content;
@@ -89,6 +142,7 @@ pub(crate) fn extract_page_text_items(
let mut rects: Vec<PdfRect> = Vec::new();
let mut clip_rects: Vec<PdfRect> = Vec::new();
let mut lines: Vec<PdfLine> = Vec::new();
let mut underline_lines: Vec<UnderlineLine> = Vec::new();
// Path construction state for m/l/h → S/s line extraction
let mut path_subpath_start: Option<(f32, f32)> = None;
@@ -97,6 +151,12 @@ pub(crate) fn extract_page_text_items(
// Completed subpaths (each a vec of line segments) for f/f* rect extraction
let mut pending_subpaths: Vec<Vec<(f32, f32, f32, f32)>> = Vec::new();
let mut fill_rects: Vec<PdfRect> = Vec::new();
// `re` rects awaiting a paint operator. Underline detection must only
// see painted rects: a `re W n` clip path or `re n` no-op draws nothing
// on the page, so treating every `re` as ink would underline text that
// merely sits near an invisible clip boundary.
let mut pending_re_rects: Vec<PdfRect> = Vec::new();
let mut painted_rects: Vec<PdfRect> = Vec::new();
// Get fonts for encoding
let fonts = doc.get_page_fonts(page_id).unwrap_or_default();
@@ -114,6 +174,8 @@ pub(crate) fn extract_page_text_items(
std::collections::HashMap::new();
let mut inline_cmaps: std::collections::HashMap<String, crate::tounicode::CMapEntry> =
std::collections::HashMap::new();
let mut font_style_flags: std::collections::HashMap<String, (bool, bool)> =
std::collections::HashMap::new();
for (font_name, font_dict) in &fonts {
let resource_name = String::from_utf8_lossy(font_name).to_string();
if let Ok(base_font) = font_dict.get(b"BaseFont") {
@@ -122,6 +184,12 @@ pub(crate) fn extract_page_text_items(
font_base_names.insert(resource_name.clone(), base_name);
}
}
// Descriptor style flags rescue subset fonts whose BaseFont names
// are opaque tags the name heuristics can't read.
let style = descriptor_style_flags(doc, font_dict, style_cache);
if style != (false, false) {
font_style_flags.insert(resource_name.clone(), style);
}
// Track ToUnicode object reference, with FontFile2 fallback for Identity-H/V.
// Also handle inline ToUnicode streams.
match font_dict.get(b"ToUnicode") {
@@ -188,12 +256,15 @@ pub(crate) fn extract_page_text_items(
// Graphics state tracking
let mut ctm = [1.0f32, 0.0, 0.0, 1.0, 0.0, 0.0]; // Current Transformation Matrix
let mut text_rendering_mode: i32 = 0; // 0=fill, 1=stroke, 2=fill+stroke, 3=invisible
let mut line_width: f32 = 1.0;
#[derive(Clone)]
struct SavedGraphicsState {
ctm: [f32; 6],
text_rendering_mode: i32,
line_width: f32,
char_spacing: f32,
word_spacing: f32,
text_rise: f32,
text_leading: f32,
current_font: String,
current_font_size: f32,
@@ -206,6 +277,7 @@ pub(crate) fn extract_page_text_items(
let mut text_leading: f32 = 0.0; // TL parameter (in text-space units)
let mut char_spacing: f32 = 0.0; // Tc parameter (extra spacing per character, unscaled)
let mut word_spacing: f32 = 0.0; // Tw parameter (extra spacing per space char, unscaled)
let mut text_rise: f32 = 0.0; // Ts parameter (baseline shift for super/subscripts, unscaled)
let mut text_matrix = [1.0f32, 0.0, 0.0, 1.0, 0.0, 0.0];
let mut line_matrix = [1.0f32, 0.0, 0.0, 1.0, 0.0, 0.0];
let mut in_text_block = false;
@@ -227,6 +299,10 @@ pub(crate) fn extract_page_text_items(
let mut suppress_glyph_extraction = false;
let mut actual_text_start_tm: Option<[f32; 6]> = None; // text matrix at BDC entry
let mut actual_text_glyph_tm: Option<[f32; 6]> = None; // text matrix at first glyph inside BDC
// Text rise in effect at each captured matrix — the item must render at
// the rise of its GLYPHS, not whatever rise is set by EMC time.
let mut actual_text_start_rise: f32 = 0.0;
let mut actual_text_glyph_rise: Option<f32> = None;
/// Get the innermost MCID from the marked content stack.
fn current_mcid(stack: &[MarkedContentEntry]) -> Option<i64> {
stack.iter().rev().find_map(|e| e.mcid)
@@ -240,8 +316,10 @@ pub(crate) fn extract_page_text_items(
gstate_stack.push(SavedGraphicsState {
ctm,
text_rendering_mode,
line_width,
char_spacing,
word_spacing,
text_rise,
text_leading,
current_font: current_font.clone(),
current_font_size,
@@ -252,8 +330,10 @@ pub(crate) fn extract_page_text_items(
if let Some(saved) = gstate_stack.pop() {
ctm = saved.ctm;
text_rendering_mode = saved.text_rendering_mode;
line_width = saved.line_width;
char_spacing = saved.char_spacing;
word_spacing = saved.word_spacing;
text_rise = saved.text_rise;
text_leading = saved.text_leading;
current_font = saved.current_font;
current_font_size = saved.current_font_size;
@@ -273,6 +353,11 @@ pub(crate) fn extract_page_text_items(
ctm = multiply_matrices(&new_matrix, &ctm);
}
}
"w" => {
if let Some(width) = op.operands.first().and_then(get_number) {
line_width = width;
}
}
"BT" => {
// Begin text block
in_text_block = true;
@@ -321,6 +406,12 @@ pub(crate) fn extract_page_text_items(
word_spacing = tw;
}
}
"Ts" => {
// Set text rise (baseline shift for superscripts/subscripts)
if let Some(ts) = op.operands.first().and_then(get_number) {
text_rise = ts;
}
}
"Td" | "TD" => {
// Move text position: TLM = T(tx,ty) × TLM; Tm = TLM
// tx,ty are in text space — must be scaled by the text line matrix
@@ -379,6 +470,7 @@ pub(crate) fn extract_page_text_items(
if suppress_glyph_extraction {
if actual_text_glyph_tm.is_none() {
actual_text_glyph_tm = Some(text_matrix);
actual_text_glyph_rise = Some(text_rise);
}
if let Some(w_ts) = w_ts_opt {
text_matrix[4] += w_ts * text_matrix[0];
@@ -408,7 +500,8 @@ pub(crate) fn extract_page_text_items(
&mut cmap_decisions,
&font_widths,
) {
let combined = multiply_matrices(&text_matrix, &ctm);
let combined =
multiply_matrices(&rise_adjusted(&text_matrix, text_rise), &ctm);
let rendered_size = effective_font_size(current_font_size, &combined);
let (x, y) = (combined[4], combined[5]);
if combined[0].abs() >= combined[1].abs() {
@@ -430,6 +523,10 @@ pub(crate) fn extract_page_text_items(
.get(&current_font)
.map(|s| s.as_str())
.unwrap_or(&current_font);
let (desc_italic, desc_bold) = font_style_flags
.get(&current_font)
.copied()
.unwrap_or((false, false));
items.push(TextItem {
text: expand_ligatures(&text),
x,
@@ -439,8 +536,10 @@ pub(crate) fn extract_page_text_items(
font: current_font.clone(),
font_size: rendered_size,
page: page_num,
is_bold: is_bold_font(base_font),
is_italic: is_italic_font(base_font),
is_bold: is_bold_font(base_font) || desc_bold,
is_italic: is_italic_font(base_font) || desc_italic,
is_underline: false,
is_strikeout: false,
item_type: ItemType::Text,
mcid: current_mcid(&marked_content_stack),
});
@@ -458,6 +557,7 @@ pub(crate) fn extract_page_text_items(
// Capture first-glyph position for ActualText
if suppress_glyph_extraction && actual_text_glyph_tm.is_none() {
actual_text_glyph_tm = Some(text_matrix);
actual_text_glyph_rise = Some(text_rise);
}
// Compute space threshold based on font metrics when available
@@ -578,6 +678,10 @@ pub(crate) fn extract_page_text_items(
.get(&current_font)
.map(|s| s.as_str())
.unwrap_or(&current_font);
let (desc_italic, desc_bold) = font_style_flags
.get(&current_font)
.copied()
.unwrap_or((false, false));
let scale_x = text_matrix[0] * ctm[0] + text_matrix[1] * ctm[2];
for (text, start_w, end_w) in &sub_items {
let offset_tm = [
@@ -588,7 +692,8 @@ pub(crate) fn extract_page_text_items(
text_matrix[4] + start_w * text_matrix[0],
text_matrix[5] + start_w * text_matrix[1],
];
let combined = multiply_matrices(&offset_tm, &ctm);
let combined =
multiply_matrices(&rise_adjusted(&offset_tm, text_rise), &ctm);
let (x, y) = (combined[4], combined[5]);
let width = if font_info.is_some() {
((end_w - start_w) * scale_x).abs()
@@ -604,8 +709,10 @@ pub(crate) fn extract_page_text_items(
font: current_font.clone(),
font_size: rendered_size,
page: page_num,
is_bold: is_bold_font(base_font),
is_italic: is_italic_font(base_font),
is_bold: is_bold_font(base_font) || desc_bold,
is_italic: is_italic_font(base_font) || desc_italic,
is_underline: false,
is_strikeout: false,
item_type: ItemType::Text,
mcid: current_mcid(&marked_content_stack),
});
@@ -629,6 +736,26 @@ pub(crate) fn extract_page_text_items(
line_matrix[4] += (-tl) * line_matrix[2];
line_matrix[5] += (-tl) * line_matrix[3];
text_matrix = line_matrix;
// Capture first-glyph position for ActualText AFTER the
// line move — the BDC-entry matrix is on the previous line.
if suppress_glyph_extraction && actual_text_glyph_tm.is_none() {
actual_text_glyph_tm = Some(text_matrix);
actual_text_glyph_rise = Some(text_rise);
}
// Advance width, as for Tj — without it the item stays
// zero-width and geometric underline/strikeout detection
// rejects it (`is_underline_candidate` needs width > 0).
let w_ts_opt = font_widths.get(&current_font).and_then(|fi| {
op.operands.first().and_then(get_operand_bytes).map(|raw| {
compute_string_width_ts(
raw,
fi,
current_font_size,
char_spacing,
word_spacing,
)
})
});
if !((text_rendering_mode == 3 && !include_invisible)
|| suppress_glyph_extraction
|| op.operands.is_empty())
@@ -646,7 +773,8 @@ pub(crate) fn extract_page_text_items(
&font_widths,
) {
if !text.trim().is_empty() {
let combined = multiply_matrices(&text_matrix, &ctm);
let combined =
multiply_matrices(&rise_adjusted(&text_matrix, text_rise), &ctm);
if combined[0].abs() >= combined[1].abs() {
rotation_votes.horizontal += 1;
} else {
@@ -654,27 +782,45 @@ pub(crate) fn extract_page_text_items(
}
let rendered_size = effective_font_size(current_font_size, &combined);
let (x, y) = (combined[4], combined[5]);
let width = w_ts_opt
.map(|w_ts| {
(w_ts * (text_matrix[0] * ctm[0] + text_matrix[1] * ctm[2]))
.abs()
})
.unwrap_or(0.0);
let base_font = font_base_names
.get(&current_font)
.map(|s| s.as_str())
.unwrap_or(&current_font);
let (desc_italic, desc_bold) = font_style_flags
.get(&current_font)
.copied()
.unwrap_or((false, false));
items.push(TextItem {
text: expand_ligatures(&text),
x,
y,
width: 0.0,
width,
height: rendered_size,
font: current_font.clone(),
font_size: rendered_size,
page: page_num,
is_bold: is_bold_font(base_font),
is_italic: is_italic_font(base_font),
is_bold: is_bold_font(base_font) || desc_bold,
is_italic: is_italic_font(base_font) || desc_italic,
is_underline: false,
is_strikeout: false,
item_type: ItemType::Text,
mcid: current_mcid(&marked_content_stack),
});
}
}
}
// Advance regardless of visibility so later show-text
// operators on the same line stay positioned (as for Tj).
if let Some(w_ts) = w_ts_opt {
text_matrix[4] += w_ts * text_matrix[0];
text_matrix[5] += w_ts * text_matrix[1];
}
}
"Do" => {
// XObject invocation - could be an image or form
@@ -705,6 +851,8 @@ pub(crate) fn extract_page_text_items(
page: page_num,
is_bold: false,
is_italic: false,
is_underline: false,
is_strikeout: false,
item_type: ItemType::Image,
mcid: current_mcid(&marked_content_stack),
});
@@ -718,6 +866,7 @@ pub(crate) fn extract_page_text_items(
font_cmaps,
&ctm,
&mut cmap_decisions,
style_cache,
);
items.extend(form_items);
}
@@ -758,7 +907,9 @@ pub(crate) fn extract_page_text_items(
if actual_text.is_some() {
suppress_glyph_extraction = true;
actual_text_start_tm = Some(text_matrix);
actual_text_start_rise = text_rise;
actual_text_glyph_tm = None; // reset — will be captured at first Tj/TJ
actual_text_glyph_rise = None;
}
marked_content_stack.push(MarkedContentEntry { actual_text, mcid });
}
@@ -771,9 +922,11 @@ pub(crate) fn extract_page_text_items(
// Tj may have moved the text position to the correct line —
// the BDC-entry position can be on the previous line.
let glyph_tm = actual_text_glyph_tm.take();
let glyph_rise = actual_text_glyph_rise.take();
let entry_tm = actual_text_start_tm.take();
if let Some(start_tm) = glyph_tm.or(entry_tm) {
let combined = multiply_matrices(&start_tm, &ctm);
let rise = glyph_rise.unwrap_or(actual_text_start_rise);
let combined = multiply_matrices(&rise_adjusted(&start_tm, rise), &ctm);
if combined[0].abs() >= combined[1].abs() {
rotation_votes.horizontal += 1;
} else {
@@ -790,6 +943,10 @@ pub(crate) fn extract_page_text_items(
.get(&current_font)
.map(|s| s.as_str())
.unwrap_or(&current_font);
let (desc_italic, desc_bold) = font_style_flags
.get(&current_font)
.copied()
.unwrap_or((false, false));
items.push(TextItem {
text: expand_ligatures(&at),
x,
@@ -799,8 +956,10 @@ pub(crate) fn extract_page_text_items(
font: current_font.clone(),
font_size: rendered_size,
page: page_num,
is_bold: is_bold_font(base_font),
is_italic: is_italic_font(base_font),
is_bold: is_bold_font(base_font) || desc_bold,
is_italic: is_italic_font(base_font) || desc_italic,
is_underline: false,
is_strikeout: false,
item_type: ItemType::Text,
mcid: entry
.mcid
@@ -825,13 +984,19 @@ pub(crate) fn extract_page_text_items(
let y_dev = rx * ctm[1] + ry * ctm[3] + ctm[5];
let w_dev = rw * ctm[0];
let h_dev = rh * ctm[3];
rects.push(PdfRect {
let rect = PdfRect {
x: x_dev,
y: y_dev,
width: w_dev,
height: h_dev,
page: page_num,
});
};
// Underline detection must only see rects that are
// actually painted — a `re` used purely as a clip path
// (`re W n`) or discarded (`re n`) draws nothing. Hold
// the rect as pending until a paint operator confirms it.
pending_re_rects.push(rect.clone());
rects.push(rect);
}
}
// ── Path construction operators ──────────────────────
@@ -881,10 +1046,8 @@ pub(crate) fn extract_page_text_items(
}
}
for (x1, y1, x2, y2) in pending_lines.drain(..) {
let x1d = x1 * ctm[0] + y1 * ctm[2] + ctm[4];
let y1d = x1 * ctm[1] + y1 * ctm[3] + ctm[5];
let x2d = x2 * ctm[0] + y2 * ctm[2] + ctm[4];
let y2d = x2 * ctm[1] + y2 * ctm[3] + ctm[5];
let (x1d, y1d) = transform_path_point(x1, y1, &ctm);
let (x2d, y2d) = transform_path_point(x2, y2, &ctm);
lines.push(PdfLine {
x1: x1d,
y1: y1d,
@@ -892,7 +1055,16 @@ pub(crate) fn extract_page_text_items(
y2: y2d,
page: page_num,
});
underline_lines.push(UnderlineLine {
x1: x1d,
y1: y1d,
x2: x2d,
y2: y2d,
stroke_width: transformed_stroke_width(line_width, &ctm, x1, y1, x2, y2),
page: page_num,
});
}
painted_rects.append(&mut pending_re_rects);
pending_subpaths.clear();
path_subpath_start = None;
path_current = None;
@@ -908,10 +1080,8 @@ pub(crate) fn extract_page_text_items(
}
}
for (x1, y1, x2, y2) in pending_lines.drain(..) {
let x1d = x1 * ctm[0] + y1 * ctm[2] + ctm[4];
let y1d = x1 * ctm[1] + y1 * ctm[3] + ctm[5];
let x2d = x2 * ctm[0] + y2 * ctm[2] + ctm[4];
let y2d = x2 * ctm[1] + y2 * ctm[3] + ctm[5];
let (x1d, y1d) = transform_path_point(x1, y1, &ctm);
let (x2d, y2d) = transform_path_point(x2, y2, &ctm);
lines.push(PdfLine {
x1: x1d,
y1: y1d,
@@ -919,7 +1089,16 @@ pub(crate) fn extract_page_text_items(
y2: y2d,
page: page_num,
});
underline_lines.push(UnderlineLine {
x1: x1d,
y1: y1d,
x2: x2d,
y2: y2d,
stroke_width: transformed_stroke_width(line_width, &ctm, x1, y1, x2, y2),
page: page_num,
});
}
painted_rects.append(&mut pending_re_rects);
pending_subpaths.clear();
path_subpath_start = None;
path_current = None;
@@ -977,6 +1156,7 @@ pub(crate) fn extract_page_text_items(
}
}
}
painted_rects.append(&mut pending_re_rects);
pending_lines.clear();
path_subpath_start = None;
path_current = None;
@@ -1042,7 +1222,10 @@ pub(crate) fn extract_page_text_items(
// Do NOT clear pending_lines — the following `n` does that
}
"n" => {
// end path (no-op): discard
// end path (no-op): discard — including any `re` rects that
// were only ever part of a clip path (`re W n`), which draw
// no ink and must not feed underline detection.
pending_re_rects.clear();
pending_lines.clear();
pending_subpaths.clear();
path_subpath_start = None;
@@ -1052,6 +1235,12 @@ pub(crate) fn extract_page_text_items(
}
}
// Underline detection reads only painted ink: `re` rects confirmed by
// a paint operator plus filled-subpath rects — never clip-only rects,
// which draw nothing.
let mut underline_rects = painted_rects;
underline_rects.extend(fill_rects.iter().cloned());
// Only use clip/fill rects when no `re` rects exist on this page.
// Clip rects take priority over fill rects, but first we deduplicate
// them: some PDFs wrap every text block in a full-page W* clip path,
@@ -1081,8 +1270,17 @@ pub(crate) fn extract_page_text_items(
// Some PDFs embed landscape content in portrait pages using a rotated text
// matrix (e.g. [0, b, -b, 0, tx, ty] for 90° CCW). The layout engine
// assumes x=horizontal, y=vertical — so we swap coordinates to match.
let (items, rects, lines, coords_rotated) =
let (mut items, rects, lines, coords_rotated) =
correct_rotated_page(items, rects, lines, &rotation_votes);
if coords_rotated {
rotate_underline_graphics(&mut underline_rects, &mut underline_lines);
}
super::underline::mark_underlined_items(
&mut items,
&underline_rects,
&underline_lines,
page_num,
);
let items = super::merge_text_items(items);
let items = super::merge_subscript_items(items);
@@ -1168,6 +1366,27 @@ fn correct_rotated_page(
(items, rects, lines, true)
}
fn rotate_underline_graphics(rects: &mut [PdfRect], lines: &mut [UnderlineLine]) {
for rect in rects {
let new_x = rect.y;
let new_y = -(rect.x + rect.width.abs());
rect.x = new_x;
rect.y = new_y;
std::mem::swap(&mut rect.width, &mut rect.height);
}
for line in lines {
let new_x1 = line.y1;
let new_y1 = -line.x1;
let new_x2 = line.y2;
let new_y2 = -line.x2;
line.x1 = new_x1;
line.y1 = new_y1;
line.x2 = new_x2;
line.y2 = new_y2;
}
}
/// Remove near-duplicate rects (same coordinates within 0.5 pt tolerance).
/// Some PDFs emit a full-page clip path for every text block, producing
/// thousands of identical rects. After dedup these collapse to one rect,
@@ -1217,6 +1436,64 @@ mod tests {
}
}
fn simple_doc_with_content(content: &[u8]) -> (lopdf::Document, lopdf::ObjectId) {
use lopdf::{dictionary, Object, Stream};
let mut doc = lopdf::Document::new();
let widths: Vec<Object> = (0..=255).map(|_| 600.into()).collect();
let font_id = doc.add_object(dictionary! {
"Type" => "Font",
"Subtype" => "Type1",
"BaseFont" => "Helvetica",
"FirstChar" => 0,
"LastChar" => 255,
"Widths" => Object::Array(widths),
});
let content_id = doc.add_object(Object::Stream(Stream::new(
dictionary! {},
content.to_vec(),
)));
let page_id = doc.add_object(dictionary! {
"Type" => "Page",
"Contents" => Object::Reference(content_id),
"Resources" => dictionary! {
"Font" => dictionary! {
"F1" => Object::Reference(font_id),
},
},
"MediaBox" => vec![0.into(), 0.into(), 612.into(), 792.into()],
});
let pages_id = doc.add_object(dictionary! {
"Type" => "Pages",
"Count" => Object::Integer(1),
"Kids" => vec![Object::Reference(page_id)],
});
let catalog_id = doc.add_object(dictionary! {
"Type" => "Catalog",
"Pages" => Object::Reference(pages_id),
});
doc.trailer.set("Root", Object::Reference(catalog_id));
(doc, page_id)
}
fn extract_simple_items(content: &[u8]) -> Vec<TextItem> {
use crate::tounicode::FontCMaps;
let (doc, page_id) = simple_doc_with_content(content);
let font_cmaps = FontCMaps::from_doc(&doc);
let ((items, _, _), _, _) = extract_page_text_items(
&doc,
page_id,
1,
&font_cmaps,
false,
&mut FontStyleCache::new(),
)
.unwrap();
items
}
#[test]
fn test_dedup_rects_identical() {
let mut rects = vec![rect(0.0, 0.0, 612.0, 792.0, 1); 3759];
@@ -1266,6 +1543,140 @@ mod tests {
assert_eq!(single.len(), 1);
}
#[test]
fn thick_stroked_rule_does_not_mark_underline() {
let content = b"BT /F1 12 Tf 1 0 0 1 100 500 Tm (THICK) Tj ET
4 w
100 498 m 170 498 l S
BT /F1 12 Tf 1 0 0 1 100 480 Tm (THIN) Tj ET
1 w
100 478 m 160 478 l S";
let items = extract_simple_items(content);
let thick = items.iter().find(|item| item.text == "THICK").unwrap();
let thin = items.iter().find(|item| item.text == "THIN").unwrap();
assert!(!thick.is_underline);
assert!(thin.is_underline);
}
#[test]
fn rotated_page_underline_is_detected_after_coordinate_correction() {
let content = b"BT /F1 12 Tf 0 1 -1 0 200 100 Tm (HELLO) Tj ET
BT /F1 12 Tf 0 1 -1 0 240 100 Tm (WORLD) Tj ET
1 w
202 100 m 202 170 l S";
let items = extract_simple_items(content);
let hello = items.iter().find(|item| item.text == "HELLO").unwrap();
let world = items.iter().find(|item| item.text == "WORLD").unwrap();
assert!(hello.is_underline);
assert!(!world.is_underline);
}
#[test]
fn quote_operator_text_carries_advance_width() {
// `'` (move-to-next-line-and-show-text) must retain the string's
// advance width like Tj — zero-width items are invisible to
// geometric underline/strikeout detection.
let content = b"BT /F1 12 Tf 12 TL 1 0 0 1 100 512 Tm (first) Tj (struck) ' ET
1 w
99 503 m 145 503 l S";
let items = extract_simple_items(content);
let struck = items.iter().find(|item| item.text == "struck").unwrap();
// 6 glyphs x 600/1000 x 12pt = 43.2pt, drawn one leading below Tm.
assert!((struck.width - 43.2).abs() < 0.1);
assert!((struck.y - 500.0).abs() < 0.1);
assert!(struck.is_strikeout);
assert!(!struck.is_underline);
}
#[test]
fn quote_operator_advances_text_matrix() {
// Text shown after `'` on the same line must start past the shown
// string: "CD" lands at x=114.4 (2 glyphs x 600/1000 x 12pt after
// x=100), flush against "AB", so the merge pass joins them. Without
// the advance "CD" overlaps "AB" at x=100 and the items stay apart.
let content = b"BT /F1 12 Tf 12 TL 1 0 0 1 100 512 Tm (AB) ' (CD) Tj ET";
let items = extract_simple_items(content);
let merged = items.iter().find(|item| item.text == "ABCD").unwrap();
assert!((merged.x - 100.0).abs() < 0.1);
assert!((merged.width - 28.8).abs() < 0.1);
assert!((merged.y - 500.0).abs() < 0.1);
}
#[test]
fn text_rise_shifts_item_baseline() {
// Ts displaces the glyph origin vertically without touching the
// advance; the next run at rise 0 must return to the original
// baseline and follow the raised run horizontally.
let content =
b"BT /F1 12 Tf 1 0 0 1 100 500 Tm (base) Tj 5 Ts (super) Tj 0 Ts (after) Tj ET";
let items = extract_simple_items(content);
let base = items.iter().find(|item| item.text == "base").unwrap();
let raised = items.iter().find(|item| item.text == "super").unwrap();
let after = items.iter().find(|item| item.text == "after").unwrap();
assert!((base.y - 500.0).abs() < 0.1);
assert!((raised.y - 505.0).abs() < 0.1);
assert!((after.y - 500.0).abs() < 0.1);
assert!(after.x > raised.x);
}
#[test]
fn actual_text_item_uses_glyph_rise() {
// The ActualText replacement item must render at the rise in
// effect when its glyphs were drawn — not the unshifted BDC
// baseline, and not whatever rise is set by EMC time.
let content = b"BT /F1 12 Tf 1 0 0 1 100 500 Tm \
/Span <</ActualText (super) >> BDC 5 Ts (sup) Tj 0 Ts EMC (after) Tj ET";
let items = extract_simple_items(content);
let sup = items.iter().find(|item| item.text == "super").unwrap();
let after = items.iter().find(|item| item.text == "after").unwrap();
assert!((sup.y - 505.0).abs() < 0.1);
assert!((after.y - 500.0).abs() < 0.1);
}
#[test]
fn actual_text_shown_with_quote_op_uses_moved_risen_baseline() {
// When the tagged span's show op is `'`, the glyph position is
// only known AFTER its line move — falling back to the BDC-entry
// matrix would place the item on the previous line, unrisen.
let content = b"BT /F1 12 Tf 14 TL 1 0 0 1 100 500 Tm \
/Span <</ActualText (replaced) >> BDC 3 Ts (raw) ' 0 Ts EMC ET";
let items = extract_simple_items(content);
let item = items.iter().find(|item| item.text == "replaced").unwrap();
// Line move: 500 - 14 = 486; rise: +3 -> 489.
assert!((item.y - 489.0).abs() < 0.1);
assert!(item.width > 0.0);
}
#[test]
fn strikeout_detected_on_risen_text() {
// The rule crosses the glyphs at their risen position; without the
// rise in item.y the strike window sits 4pt too low and misses.
let content = b"BT /F1 12 Tf 1 0 0 1 100 500 Tm 4 Ts (struck) Tj ET
1 w
99 507 m 145 507 l S";
let items = extract_simple_items(content);
let struck = items.iter().find(|item| item.text == "struck").unwrap();
assert!((struck.y - 504.0).abs() < 0.1);
assert!(struck.is_strikeout);
assert!(!struck.is_underline);
}
#[test]
fn test_skip_excessive_operations() {
use crate::tounicode::FontCMaps;
@@ -1300,7 +1711,15 @@ mod tests {
doc.add_object(catalog);
let font_cmaps = FontCMaps::from_doc(&doc);
let result = extract_page_text_items(&doc, page_id, 1, &font_cmaps, false).unwrap();
let result = extract_page_text_items(
&doc,
page_id,
1,
&font_cmaps,
false,
&mut FontStyleCache::new(),
)
.unwrap();
let ((items, rects, lines), _has_gid, _coords_rotated) = result;
assert!(items.is_empty());
assert!(rects.is_empty());
@@ -1382,8 +1801,15 @@ BT 30 700 Tm <41> Tj ET";
doc.trailer.set("Root", Object::Reference(catalog_id));
let font_cmaps = FontCMaps::from_doc(&doc);
let ((items, _, _), _, _) =
extract_page_text_items(&doc, page_id, 1, &font_cmaps, false).unwrap();
let ((items, _, _), _, _) = extract_page_text_items(
&doc,
page_id,
1,
&font_cmaps,
false,
&mut FontStyleCache::new(),
)
.unwrap();
let text = items
.iter()
.map(|item| item.text.as_str())
+332 -1
View File
@@ -4,7 +4,7 @@ use crate::glyph_names::glyph_to_char;
use crate::tounicode::FontCMaps;
use crate::types::{FontEncodingMap, FontWidthInfo, PageFontEncodings, PageFontWidths};
use log::debug;
use lopdf::{Document, Encoding, Object};
use lopdf::{Document, Encoding, Object, ObjectId};
use std::collections::HashMap;
#[derive(Debug, Copy, Clone, PartialEq, Eq)]
@@ -739,6 +739,171 @@ pub(crate) fn get_font_file2_obj_num(doc: &Document, font_dict: &lopdf::Dictiona
.map(|r| r.0)
}
/// Document-scoped memo of embedded-font style flags, keyed by the
/// FontFile2/FontFile3 stream's object id. The same font program is
/// referenced from every page that uses the font, and decompressing +
/// parsing it dominates `descriptor_style_flags` — without the memo that
/// cost repeats per page whenever the descriptor leaves a flag unset
/// (the common case: regular fonts report neither italic nor bold).
#[derive(Debug, Default)]
pub(crate) struct FontStyleCache {
by_font_file: HashMap<ObjectId, (bool, bool)>,
}
impl FontStyleCache {
pub(crate) fn new() -> Self {
Self::default()
}
}
/// Style flags from the FontDescriptor, which survive subset fonts whose
/// BaseFont names are opaque tags ("Tc1", "ABCDEF+F1") that defeat the
/// name-based bold/italic heuristics.
///
/// Italic: `ItalicAngle` beyond a few degrees, or Flags bit 7 (Italic,
/// value 64). Bold: Flags bit 19 (ForceBold, value 1<<18). The small
/// ItalicAngle threshold skips fonts that declare a token slant.
pub(crate) fn descriptor_style_flags(
doc: &Document,
font_dict: &lopdf::Dictionary,
style_cache: &mut FontStyleCache,
) -> (bool, bool) {
let descriptor = font_dict
.get(b"FontDescriptor")
.ok()
.and_then(|obj| resolve_dict(doc, obj))
.or_else(|| {
// Type0 fonts hang the descriptor off DescendantFonts[0].
let desc_fonts = font_dict.get(b"DescendantFonts").ok()?;
let desc_fonts = resolve_array(doc, desc_fonts)?;
let cid_font_dict = resolve_dict(doc, desc_fonts.first()?)?;
resolve_dict(doc, cid_font_dict.get(b"FontDescriptor").ok()?)
});
let Some(descriptor) = descriptor else {
return (false, false);
};
let italic_angle = descriptor
.get(b"ItalicAngle")
.ok()
.and_then(|obj| match obj {
Object::Integer(i) => Some(*i as f32),
Object::Real(r) => Some(*r),
_ => None,
})
.unwrap_or(0.0);
let flags = descriptor
.get(b"Flags")
.ok()
.and_then(|obj| obj.as_i64().ok())
.unwrap_or(0);
let mut italic = italic_angle.abs() >= 4.0 || flags & (1 << 6) != 0;
let mut bold = flags & (1 << 18) != 0;
// Descriptors lie: subset generators write ItalicAngle 0 for genuinely
// italic faces. The embedded font file keeps the truth — OS/2
// fsSelection (via `Face::is_italic`) and the post table's italicAngle.
if !italic || !bold {
if let Some(ff_ref) = font_file_ref(descriptor) {
let (emb_italic, emb_bold) = *style_cache
.by_font_file
.entry(ff_ref)
.or_insert_with(|| embedded_style_flags(doc, ff_ref));
italic = italic || emb_italic;
bold = bold || emb_bold;
}
}
(italic, bold)
}
/// Style flags parsed from an embedded font program stream.
fn embedded_style_flags(doc: &Document, ff_ref: ObjectId) -> (bool, bool) {
let Some(data) = font_file_data(doc, ff_ref) else {
return (false, false);
};
if let Ok(face) = ttf_parser::Face::parse(&data, 0) {
(
face.is_italic() || face.italic_angle().abs() >= 4.0,
face.is_bold(),
)
} else if let Some(name) = cff_font_name(&data) {
// FontFile3 is bare CFF (no sfnt container) — ttf_parser
// can't open it, but the CFF Name INDEX keeps the real
// PostScript name ("XXXXXX+Amplitude-LightItalic") even
// when the descriptor was rewritten to claim upright.
(
crate::text_utils::is_italic_font(&name),
crate::text_utils::is_bold_font(&name),
)
} else {
(false, false)
}
}
/// First PostScript name from a bare CFF font's Name INDEX (CFF spec §7).
fn cff_font_name(data: &[u8]) -> Option<String> {
// Header: major(1) minor(1) hdrSize(1) offSize(1); major must be 1.
if data.len() < 4 || data[0] != 1 {
return None;
}
let hdr_size = data[2] as usize;
// Name INDEX: count(u16) offSize(u8) offsets[count+1] data
let count = u16::from_be_bytes([*data.get(hdr_size)?, *data.get(hdr_size + 1)?]) as usize;
if count == 0 {
return None;
}
let off_size = *data.get(hdr_size + 2)? as usize;
if !(1..=4).contains(&off_size) {
return None;
}
let read_offset = |idx: usize| -> Option<usize> {
let at = hdr_size + 3 + idx * off_size;
let bytes = data.get(at..at + off_size)?;
let mut v = 0usize;
for b in bytes {
v = (v << 8) | *b as usize;
}
Some(v)
};
let start = read_offset(0)?;
let end = read_offset(1)?;
if start == 0 || end < start {
return None;
}
// Offsets are 1-based from the byte before the object data.
let objects_base = hdr_size + 3 + (count + 1) * off_size - 1;
let name = data.get(objects_base + start..objects_base + end)?;
Some(String::from_utf8_lossy(name).to_string())
}
/// FontFile2/FontFile3 stream reference from a FontDescriptor.
fn font_file_ref(descriptor: &lopdf::Dictionary) -> Option<ObjectId> {
descriptor
.get(b"FontFile2")
.ok()
.and_then(|o| o.as_reference().ok())
.or_else(|| {
descriptor
.get(b"FontFile3")
.ok()
.and_then(|o| o.as_reference().ok())
})
}
/// Decompressed embedded font program bytes.
fn font_file_data(doc: &Document, ff_ref: ObjectId) -> Option<Vec<u8>> {
let stream = doc
.get_object(ff_ref)
.and_then(lopdf::Object::as_stream)
.ok()?;
Some(
stream
.decompressed_content()
.unwrap_or_else(|_| stream.content.clone()),
)
}
/// Decode text from a PDF string operand using font CMaps, encodings, and fallbacks.
#[allow(clippy::too_many_arguments)]
pub(crate) fn extract_text_from_operand(
@@ -1262,6 +1427,172 @@ mod tests {
}
}
fn doc_with_descriptor(descriptor: lopdf::Dictionary) -> (Document, lopdf::Dictionary) {
let mut doc = Document::with_version("1.4");
let desc_id = doc.add_object(descriptor);
let font_dict = dictionary! {
"Type" => "Font",
"Subtype" => "TrueType",
"BaseFont" => "Tc1",
"FontDescriptor" => desc_id,
};
(doc, font_dict)
}
#[test]
fn descriptor_italic_angle_sets_italic() {
// Subset font with an opaque BaseFont name ("Tc1") — the name
// heuristic sees nothing, the descriptor carries the truth.
let (doc, font_dict) = doc_with_descriptor(dictionary! {
"Type" => "FontDescriptor",
"FontName" => "Tc1",
"ItalicAngle" => -12,
"Flags" => 32,
});
assert_eq!(
descriptor_style_flags(&doc, &font_dict, &mut FontStyleCache::new()),
(true, false)
);
}
#[test]
fn descriptor_italic_flag_bit_sets_italic() {
let (doc, font_dict) = doc_with_descriptor(dictionary! {
"Type" => "FontDescriptor",
"FontName" => "Tc1",
"ItalicAngle" => 0,
"Flags" => 64, // bit 7: Italic
});
assert_eq!(
descriptor_style_flags(&doc, &font_dict, &mut FontStyleCache::new()),
(true, false)
);
}
#[test]
fn descriptor_force_bold_flag_sets_bold() {
let (doc, font_dict) = doc_with_descriptor(dictionary! {
"Type" => "FontDescriptor",
"FontName" => "Tc1",
"ItalicAngle" => 0,
"Flags" => 1 << 18, // ForceBold
});
assert_eq!(
descriptor_style_flags(&doc, &font_dict, &mut FontStyleCache::new()),
(false, true)
);
}
#[test]
fn tiny_italic_angle_is_not_italic() {
// A token 1-degree slant is optical correction, not italic.
let (doc, font_dict) = doc_with_descriptor(dictionary! {
"Type" => "FontDescriptor",
"FontName" => "Tc1",
"ItalicAngle" => lopdf::Object::Real(-1.0),
"Flags" => 32,
});
assert_eq!(
descriptor_style_flags(&doc, &font_dict, &mut FontStyleCache::new()),
(false, false)
);
}
#[test]
fn missing_descriptor_yields_no_flags() {
let doc = Document::with_version("1.4");
let font_dict = dictionary! { "Type" => "Font", "BaseFont" => "Tc1" };
assert_eq!(
descriptor_style_flags(&doc, &font_dict, &mut FontStyleCache::new()),
(false, false)
);
}
#[test]
fn type0_descendant_descriptor_is_resolved() {
let mut doc = Document::with_version("1.4");
let desc_id = doc.add_object(dictionary! {
"Type" => "FontDescriptor",
"FontName" => "ABCDEF+F1",
"ItalicAngle" => -15,
});
let cid_id = doc.add_object(dictionary! {
"Type" => "Font",
"Subtype" => "CIDFontType2",
"FontDescriptor" => desc_id,
});
let font_dict = dictionary! {
"Type" => "Font",
"Subtype" => "Type0",
"BaseFont" => "ABCDEF+F1",
"DescendantFonts" => vec![lopdf::Object::Reference(cid_id)],
};
assert_eq!(
descriptor_style_flags(&doc, &font_dict, &mut FontStyleCache::new()),
(true, false)
);
}
/// Bare CFF: header + Name INDEX only — enough for `cff_font_name`.
fn bare_cff_with_name(name: &str) -> Vec<u8> {
let mut data = vec![1, 0, 4, 1]; // major, minor, hdrSize, offSize
data.extend_from_slice(&1u16.to_be_bytes()); // Name INDEX count
data.push(1); // offSize
data.push(1); // offset of first name
data.push(1 + name.len() as u8); // offset past last name
data.extend_from_slice(name.as_bytes());
data
}
#[test]
fn embedded_font_style_is_cached_by_font_file_object() {
use lopdf::{Object, Stream};
let mut doc = Document::with_version("1.4");
let ff_id = doc.add_object(Object::Stream(Stream::new(
dictionary! {},
bare_cff_with_name("ABCDEF+Test-BoldItalic"),
)));
let desc_id = doc.add_object(dictionary! {
"Type" => "FontDescriptor",
"FontName" => "ABCDEF+Test-BoldItalic",
"ItalicAngle" => 0,
"Flags" => 32,
"FontFile3" => ff_id,
});
let font_dict = dictionary! {
"Type" => "Font",
"Subtype" => "Type1",
"BaseFont" => "Tc1",
"FontDescriptor" => desc_id,
};
let mut cache = FontStyleCache::new();
assert_eq!(
descriptor_style_flags(&doc, &font_dict, &mut cache),
(true, true)
);
assert_eq!(cache.by_font_file.len(), 1);
// Replace the font program with garbage: a repeat call must serve
// the memo instead of re-reading the stream — repeated per-page
// decompression is exactly what the cache exists to avoid.
doc.objects.insert(
ff_id,
Object::Stream(Stream::new(dictionary! {}, vec![0u8; 4])),
);
assert_eq!(
descriptor_style_flags(&doc, &font_dict, &mut cache),
(true, true)
);
// A cold cache parses the (now garbage) stream, proving the warm
// call above answered from the memo.
assert_eq!(
descriptor_style_flags(&doc, &font_dict, &mut FontStyleCache::new()),
(false, false)
);
}
#[test]
fn compute_string_width_ts_no_tc_tw() {
// Without Tc/Tw (both 0), width = glyph widths only
+4
View File
@@ -1494,6 +1494,8 @@ mod tests {
page,
is_bold: false,
is_italic: false,
is_underline: false,
is_strikeout: false,
item_type: ItemType::Text,
mcid: None,
}
@@ -1623,6 +1625,8 @@ mod tests {
page,
is_bold: false,
is_italic: false,
is_underline: false,
is_strikeout: false,
item_type: ItemType::Text,
mcid: None,
});
+4
View File
@@ -78,6 +78,8 @@ pub fn extract_page_links(doc: &Document, page_id: ObjectId, page_num: u32) -> V
page: page_num,
is_bold: false,
is_italic: false,
is_underline: false,
is_strikeout: false,
item_type: ItemType::Link(url),
mcid: None,
});
@@ -316,6 +318,8 @@ pub(crate) fn walk_form_fields(
page: page_num,
is_bold: false,
is_italic: false,
is_underline: false,
is_strikeout: false,
item_type: ItemType::FormField,
mcid: None,
});
+265 -8
View File
@@ -6,11 +6,12 @@ pub(crate) mod content_stream;
mod fonts;
mod layout;
mod links;
pub(crate) mod underline;
mod xobjects;
use crate::text_utils::is_rtl_text;
use crate::tounicode::FontCMaps;
use crate::types::{PageExtraction, TextItem};
use crate::types::{PageExtraction, PdfLine, PdfRect, TextItem};
use crate::PdfError;
use log::debug;
use lopdf::{Document, Object, ObjectId};
@@ -23,6 +24,7 @@ use links::{extract_form_fields, extract_page_links};
// Re-export public types so existing `crate::extractor::X` paths keep working.
pub use crate::text_utils::{is_bold_font, is_italic_font};
pub use crate::types::{ItemType, TextLine};
pub(crate) use fonts::FontStyleCache;
pub(crate) use layout::detect_columns;
pub use layout::group_into_lines;
pub(crate) use layout::group_into_lines_with_thresholds;
@@ -160,6 +162,9 @@ fn extract_positioned_text_impl(
let mut all_lines = Vec::new();
let mut page_thresholds: PageThresholds = HashMap::new();
let mut gid_encoded_pages: HashSet<u32> = HashSet::new();
// Embedded-font style flags are document-scoped: the same font program
// is shared across pages, so parse it once, not once per page.
let mut style_cache = FontStyleCache::new();
// Build page ObjectId → page number map for form field extraction
let page_id_to_num: HashMap<ObjectId, u32> =
@@ -171,8 +176,14 @@ fn extract_positioned_text_impl(
continue;
}
}
let ((mut items, rects, lines), has_gid_fonts, _coords_rotated) =
extract_page_text_items(doc, page_id, *page_num, font_cmaps, include_invisible)?;
let ((mut items, rects, lines), has_gid_fonts, _coords_rotated) = extract_page_text_items(
doc,
page_id,
*page_num,
font_cmaps,
include_invisible,
&mut style_cache,
)?;
if has_gid_fonts {
gid_encoded_pages.insert(*page_num);
}
@@ -180,6 +191,7 @@ fn extract_positioned_text_impl(
if threshold > 0.10 {
page_thresholds.insert(*page_num, threshold);
}
suppress_table_underlines(&mut items, &rects, &lines, *page_num);
debug!(
"page {}: {} text items, {} rects, {} lines{}",
page_num,
@@ -226,6 +238,42 @@ fn extract_positioned_text_impl(
))
}
fn suppress_table_underlines(
items: &mut [TextItem],
rects: &[PdfRect],
lines: &[PdfLine],
page: u32,
) {
if !items
.iter()
.any(|item| item.is_underline || item.is_strikeout)
{
return;
}
let mut table_item_indices: HashSet<usize> = HashSet::new();
if !rects.is_empty() {
let (rect_tables, _) = crate::tables::detect_tables_from_rects(items, rects, page);
for table in rect_tables {
table_item_indices.extend(table.item_indices);
}
}
if !lines.is_empty() {
for table in crate::tables::detect_tables_from_lines(items, lines, page) {
table_item_indices.extend(table.item_indices);
}
}
for index in table_item_indices {
if let Some(item) = items.get_mut(index) {
item.is_underline = false;
item.is_strikeout = false;
}
}
}
// ---------------------------------------------------------------------------
// Shared helpers (used by submodules via `super::`)
// ---------------------------------------------------------------------------
@@ -533,6 +581,19 @@ pub(crate) fn merge_text_items(items: Vec<TextItem>) -> Vec<TextItem> {
if (next.font_size - first.font_size).abs() > first.font_size * 0.20 {
break;
}
// Never merge across style boundaries: the merged item
// carries `first`'s flags, so absorbing a styled run into a
// plain neighbor (or vice versa) silently erases the styling
// that markdown emission and downstream inline-styling need —
// and OR-ing underline instead would stretch `<u>` spans over
// neighboring plain text.
if next.is_bold != first.is_bold
|| next.is_italic != first.is_italic
|| next.is_underline != first.is_underline
|| next.is_strikeout != first.is_strikeout
{
break;
}
let gap = next.x - end_x;
let x_gap_max = if *preserve_stream_order && is_standalone_bullet_text(&text) {
first.font_size * 1.2
@@ -591,6 +652,8 @@ pub(crate) fn merge_text_items(items: Vec<TextItem>) -> Vec<TextItem> {
page: first.page,
is_bold: first.is_bold,
is_italic: first.is_italic,
is_underline: first.is_underline,
is_strikeout: first.is_strikeout,
item_type: first.item_type.clone(),
mcid: first.mcid,
});
@@ -668,12 +731,24 @@ pub(crate) fn merge_subscript_items(items: Vec<TextItem>) -> Vec<TextItem> {
.chars()
.last()
.is_some_and(|c| c.is_alphabetic());
if parent.font_size >= sub_threshold && ends_with_letter {
let same_marks = parent.is_underline == item.is_underline
&& parent.is_strikeout == item.is_strikeout;
if parent.font_size >= sub_threshold && ends_with_letter && same_marks {
let parent_right = parent.x + parent.width;
let gap = item.x - parent_right;
// Subscripts must be tightly adjacent (within ~1pt)
if gap < parent.font_size * 0.2 && gap > -parent.font_size * 0.3 {
parent.text.push_str(&item.text);
// Preserve the script when absorbing it: map the
// digits to Unicode sub/superscript forms so the
// raised/lowered rendering survives in extracted
// text ("H"+"2" → "H₂", "word"+"2" → "word²").
// NFKC/NFKD normalization folds these back to
// plain digits, so text matching downstream is
// unaffected. Direction from the baseline offset
// (y-up here): raised → superscript (footnote
// refs), lowered/level → subscript (chemistry).
let raised = item.y > parent.y + parent.font_size * 0.1;
parent.text.push_str(&map_script_digits(&item.text, raised));
parent.width = (item.x + item.width) - parent.x;
continue;
}
@@ -688,6 +763,21 @@ pub(crate) fn merge_subscript_items(items: Vec<TextItem>) -> Vec<TextItem> {
result
}
/// Map ASCII digits to their Unicode superscript (`raised`) or subscript
/// forms. Callers guarantee digit-only input (see `merge_subscript_items`);
/// anything else passes through unchanged.
fn map_script_digits(text: &str, raised: bool) -> String {
const SUP: [char; 10] = ['⁰', '¹', '²', '³', '⁴', '⁵', '⁶', '⁷', '⁸', '⁹'];
const SUB: [char; 10] = ['₀', '₁', '₂', '₃', '₄', '₅', '₆', '₇', '₈', '₉'];
text.chars()
.map(|c| match c.to_digit(10) {
Some(d) if raised => SUP[d as usize],
Some(d) => SUB[d as usize],
None => c,
})
.collect()
}
/// Helper to get f32 from Object
pub(crate) fn get_number(obj: &Object) -> Option<f32> {
match obj {
@@ -701,7 +791,7 @@ pub(crate) fn get_number(obj: &Object) -> Option<f32> {
mod tests {
use super::*;
use crate::text_utils::{is_cjk_char, is_rtl_char, is_rtl_text, sort_line_items};
use crate::types::{ItemType, TextLine};
use crate::types::{ItemType, PdfLine, TextLine};
use layout::{detect_columns, is_newspaper_layout, ColumnRegion};
fn make_merge_item(text: &str, x: f32, width: f32) -> TextItem {
@@ -716,6 +806,8 @@ mod tests {
page: 1,
is_bold: false,
is_italic: false,
is_underline: false,
is_strikeout: false,
item_type: ItemType::Text,
mcid: None,
}
@@ -726,6 +818,16 @@ mod tests {
item
}
fn make_line(x1: f32, y1: f32, x2: f32, y2: f32) -> PdfLine {
PdfLine {
x1,
y1,
x2,
y2,
page: 1,
}
}
#[test]
fn trace_text_preview_truncates_on_char_boundary() {
let text = format!("{}{}tail", "a".repeat(79), '\u{FFFD}');
@@ -736,6 +838,28 @@ mod tests {
assert!(preview.ends_with('\u{FFFD}'));
}
#[test]
fn merge_items_breaks_at_style_boundaries() {
// A styled run adjacent to plain text must stay a separate item —
// merging would erase the flags (italic) or stretch the span
// (underline) before markdown emission sees them.
let mut italic = make_merge_item("emphasis", 150.0, 40.0);
italic.is_italic = true;
let mut underlined = make_merge_item("term", 195.0, 20.0);
underlined.is_underline = true;
let items = vec![
make_merge_item("plain lead", 100.0, 48.0),
italic,
underlined,
make_merge_item("plain tail", 218.0, 45.0),
];
let merged = merge_text_items(items);
assert_eq!(merged.len(), 4);
assert!(merged[1].is_italic && !merged[1].is_underline);
assert!(merged[2].is_underline && !merged[2].is_italic);
assert!(!merged[3].is_underline && !merged[3].is_italic);
}
#[test]
fn merge_items_no_space_before_period() {
// Simulate Tc/Tw-adjusted width: "date" width is smaller than the gap
@@ -774,6 +898,27 @@ mod tests {
assert_eq!(merged[0].text, "hello world");
}
#[test]
fn merge_items_preserves_underline_from_later_fragment() {
// Fragments with differing underline stay separate items — OR-merging
// would stretch the eventual `<u>` span over the plain fragment.
// Line-level text assembly still joins them without a space (tight
// gap), so the rendered word is unchanged: `pre<u>fix</u>`.
let mut items = vec![
make_merge_item("pre", 100.0, 18.0),
make_merge_item("fix", 119.0, 18.0),
];
items[1].is_underline = true;
let merged = merge_text_items(items);
assert_eq!(merged.len(), 2);
assert_eq!(merged[0].text, "pre");
assert!(!merged[0].is_underline);
assert_eq!(merged[1].text, "fix");
assert!(merged[1].is_underline);
}
#[test]
fn merge_items_preserves_stream_order_for_backtracking_heading() {
// Some tagged PDFs emit first-letter ActualText fragments, then reset
@@ -851,6 +996,60 @@ mod tests {
assert_eq!(texts, vec!["", "Distant item"]);
}
#[test]
fn suppress_table_underlines_clears_line_detected_table_items() {
let mut items = vec![
make_merge_item("H1", 125.0, 20.0),
make_merge_item("H2", 225.0, 20.0),
make_merge_item("A", 125.0, 20.0),
make_merge_item("B", 225.0, 20.0),
];
items[0].y = 490.0;
items[1].y = 490.0;
items[2].y = 470.0;
items[3].y = 470.0;
for item in &mut items {
item.is_underline = true;
item.is_strikeout = true;
}
let lines = vec![
make_line(100.0, 500.0, 300.0, 500.0),
make_line(100.0, 480.0, 300.0, 480.0),
make_line(100.0, 460.0, 300.0, 460.0),
make_line(100.0, 460.0, 100.0, 500.0),
make_line(200.0, 460.0, 200.0, 500.0),
make_line(300.0, 460.0, 300.0, 500.0),
];
suppress_table_underlines(&mut items, &[], &lines, 1);
assert!(items.iter().all(|item| !item.is_underline));
assert!(items.iter().all(|item| !item.is_strikeout));
}
#[test]
fn subscript_digit_with_different_marks_is_not_absorbed() {
// A struck-out word followed by an unmarked footnote digit: merging
// would widen the parent's strikeout claim over the digit (and the
// reverse would drop the digit's own mark). Style boundaries break
// the merge, as in merge_text_items.
let mut word = make_merge_item("word", 100.0, 24.0);
word.font_size = 10.0;
word.is_strikeout = true;
let mut digit = make_merge_item("2", 124.5, 4.0);
digit.font_size = 6.0;
digit.y = word.y + 3.0;
let merged = merge_subscript_items(vec![word.clone(), digit.clone()]);
assert_eq!(merged.len(), 2);
// Same marks still merge (footnote ref inside the strike).
digit.is_strikeout = true;
let merged = merge_subscript_items(vec![word, digit]);
assert_eq!(merged.len(), 1);
assert!(merged[0].text.starts_with("word"));
}
#[test]
fn test_group_into_lines() {
let items = vec![
@@ -865,6 +1064,8 @@ mod tests {
page: 1,
is_bold: false,
is_italic: false,
is_underline: false,
is_strikeout: false,
item_type: ItemType::Text,
mcid: None,
},
@@ -879,6 +1080,8 @@ mod tests {
page: 1,
is_bold: false,
is_italic: false,
is_underline: false,
is_strikeout: false,
item_type: ItemType::Text,
mcid: None,
},
@@ -893,6 +1096,8 @@ mod tests {
page: 1,
is_bold: false,
is_italic: false,
is_underline: false,
is_strikeout: false,
item_type: ItemType::Text,
mcid: None,
},
@@ -947,6 +1152,8 @@ mod tests {
page: 1,
is_bold: false,
is_italic: false,
is_underline: false,
is_strikeout: false,
item_type: ItemType::Text,
mcid: None,
},
@@ -961,6 +1168,8 @@ mod tests {
page: 1,
is_bold: false,
is_italic: false,
is_underline: false,
is_strikeout: false,
item_type: ItemType::Text,
mcid: None,
},
@@ -975,6 +1184,8 @@ mod tests {
page: 1,
is_bold: false,
is_italic: false,
is_underline: false,
is_strikeout: false,
item_type: ItemType::Text,
mcid: None,
},
@@ -1000,6 +1211,8 @@ mod tests {
page: 1,
is_bold: false,
is_italic: false,
is_underline: false,
is_strikeout: false,
item_type: ItemType::Text,
mcid: None,
},
@@ -1014,6 +1227,8 @@ mod tests {
page: 1,
is_bold: false,
is_italic: false,
is_underline: false,
is_strikeout: false,
item_type: ItemType::Text,
mcid: None,
},
@@ -1028,6 +1243,8 @@ mod tests {
page: 1,
is_bold: false,
is_italic: false,
is_underline: false,
is_strikeout: false,
item_type: ItemType::Text,
mcid: None,
},
@@ -1055,6 +1272,8 @@ mod tests {
page: 1,
is_bold: true,
is_italic: false,
is_underline: false,
is_strikeout: false,
item_type: ItemType::Text,
mcid: None,
}
@@ -1089,6 +1308,8 @@ mod tests {
page: 1,
is_bold: false,
is_italic: false,
is_underline: false,
is_strikeout: false,
item_type: ItemType::Text,
mcid: None,
}
@@ -1124,6 +1345,8 @@ mod tests {
page: 1,
is_bold: false,
is_italic: false,
is_underline: false,
is_strikeout: false,
item_type: ItemType::Text,
mcid: None,
},
@@ -1138,6 +1361,8 @@ mod tests {
page: 1,
is_bold: false,
is_italic: false,
is_underline: false,
is_strikeout: false,
item_type: ItemType::Text,
mcid: None,
},
@@ -1152,6 +1377,8 @@ mod tests {
page: 1,
is_bold: false,
is_italic: false,
is_underline: false,
is_strikeout: false,
item_type: ItemType::Text,
mcid: None,
},
@@ -1174,6 +1401,8 @@ mod tests {
page: 1,
is_bold: false,
is_italic: false,
is_underline: false,
is_strikeout: false,
item_type: ItemType::Text,
mcid: None,
}
@@ -1286,6 +1515,8 @@ mod tests {
page: 1,
is_bold: false,
is_italic: false,
is_underline: false,
is_strikeout: false,
item_type: ItemType::Text,
mcid: None,
},
@@ -1300,6 +1531,8 @@ mod tests {
page: 1,
is_bold: false,
is_italic: false,
is_underline: false,
is_strikeout: false,
item_type: ItemType::Text,
mcid: None,
},
@@ -1324,6 +1557,8 @@ mod tests {
page: 1,
is_bold: false,
is_italic: false,
is_underline: false,
is_strikeout: false,
item_type: ItemType::Text,
mcid: None,
},
@@ -1338,6 +1573,8 @@ mod tests {
page: 1,
is_bold: false,
is_italic: false,
is_underline: false,
is_strikeout: false,
item_type: ItemType::Text,
mcid: None,
},
@@ -1378,6 +1615,8 @@ mod tests {
page,
is_bold: false,
is_italic: false,
is_underline: false,
is_strikeout: false,
item_type: ItemType::Text,
mcid: None,
}],
@@ -1422,6 +1661,8 @@ mod tests {
page,
is_bold: false,
is_italic: false,
is_underline: false,
is_strikeout: false,
item_type: ItemType::Text,
mcid: None,
}],
@@ -1466,6 +1707,8 @@ mod tests {
page,
is_bold: false,
is_italic: false,
is_underline: false,
is_strikeout: false,
item_type: ItemType::Text,
mcid: None,
}],
@@ -1503,6 +1746,8 @@ mod tests {
page: 1,
is_bold: false,
is_italic: false,
is_underline: false,
is_strikeout: false,
item_type: ItemType::Text,
mcid: None,
}
@@ -1518,7 +1763,8 @@ mod tests {
];
let merged = merge_subscript_items(items);
assert_eq!(merged.len(), 2);
assert_eq!(merged[0].text, "NH3");
// Lowered baseline → Unicode subscript form (NFKC folds back to "NH3")
assert_eq!(merged[0].text, "NH₃");
assert_eq!(merged[1].text, "Cl");
}
@@ -1532,10 +1778,21 @@ mod tests {
];
let merged = merge_subscript_items(items);
assert_eq!(merged.len(), 2);
assert_eq!(merged[0].text, "H2");
assert_eq!(merged[0].text, "H₂");
assert_eq!(merged[1].text, "O");
}
#[test]
fn test_merge_subscript_items_raised_marker_becomes_superscript() {
// Footnote reference: "word" followed by a RAISED small "2" → word²
let mut marker = make_item_fs("2", 90.0, 502.5, 2.3, 4.7);
marker.y = 502.5; // raised above the 499.0 parent baseline
let items = vec![make_item_fs("word", 78.0, 499.0, 12.0, 8.0), marker];
let merged = merge_subscript_items(items);
assert_eq!(merged.len(), 1);
assert_eq!(merged[0].text, "word²");
}
#[test]
fn test_merge_subscript_items_no_merge_far_gap() {
// Subscript-sized item that's far from the parent should NOT merge
+563
View File
@@ -0,0 +1,563 @@
//! Geometric underline detection.
//!
//! PDFs have no underline font flag — underlines are drawn as separate
//! graphics: stroked horizontal lines (`l`/`S` operators) or thin filled
//! rectangles (`re`/`f`). This pass correlates those graphics with text
//! items after extraction: an item is underlined when a horizontal
//! line/thin rect sits just below its baseline and covers most of its
//! horizontal extent.
//!
//! Repeated same-span rules are treated as table/form rulings rather than
//! underlines, which avoids marking every cell in ruled tables.
use std::collections::HashSet;
use crate::types::{ItemType, PdfRect, TextItem};
/// Max thickness (pt) for a stroked line / filled rect to count as an
/// underline rule rather than a border or decorative band.
const MAX_RULE_THICKNESS: f32 = 2.0;
/// Fraction of the item's width that the rule must cover horizontally.
const MIN_X_OVERLAP: f32 = 0.6;
/// Same-span rules repeated at this many y-levels are usually table/form
/// rulings, not semantic underlines.
const MIN_REPEATED_RULE_LEVELS: usize = 3;
/// Vertical tolerance for considering two rules to be on the same row edge.
const RULE_Y_DEDUP_EPS: f32 = 2.0;
/// Horizontal span similarity required when clustering repeated rulings.
const RULE_SPAN_OVERLAP_RATIO: f32 = 0.8;
const RULE_SPAN_WIDTH_RATIO: f32 = 1.5;
/// Multiple separated rule segments on one row are usually per-column table
/// header/body separators.
const MIN_SEGMENTED_ROW_RULES: usize = 3;
const MIN_SEGMENTED_ROW_GAPS: usize = 2;
const SEGMENTED_ROW_GAP_MIN: f32 = 12.0;
/// A single rule under several widely separated items is usually a table
/// header/body separator, not a sentence underline.
const MIN_TABULAR_RULE_ITEMS: usize = 3;
const MIN_TABULAR_RULE_GAPS: usize = 2;
const TABULAR_RULE_GAP_EM: f32 = 2.0;
#[derive(Clone)]
pub(crate) struct UnderlineLine {
pub(crate) x1: f32,
pub(crate) y1: f32,
pub(crate) x2: f32,
pub(crate) y2: f32,
pub(crate) stroke_width: f32,
pub(crate) page: u32,
}
/// A horizontal rule candidate in page coordinates (PDF y-up).
#[derive(Clone)]
struct Rule {
x1: f32,
x2: f32,
y: f32,
}
impl Rule {
fn width(&self) -> f32 {
self.x2 - self.x1
}
}
fn rules_from_graphics(rects: &[PdfRect], lines: &[UnderlineLine], page: u32) -> Vec<Rule> {
let mut rules: Vec<Rule> = Vec::new();
for l in lines {
if l.page != page {
continue;
}
// Horizontal stroked line (tolerate slight skew).
if l.stroke_width <= MAX_RULE_THICKNESS && (l.y1 - l.y2).abs() <= MAX_RULE_THICKNESS {
let (x1, x2) = if l.x1 <= l.x2 {
(l.x1, l.x2)
} else {
(l.x2, l.x1)
};
if x2 - x1 > 1.0 {
rules.push(Rule {
x1,
x2,
y: (l.y1 + l.y2) / 2.0,
});
}
}
}
for r in rects {
if r.page != page {
continue;
}
// Thin filled rect used as an underline rule. Extents are
// normalized first: `re` operands pass through the CTM, so
// width/height can be negative (flipped axes / negative scale) —
// without normalization negative-width rules are missed and
// negative-height bands sneak past the thickness check.
let (x1, x2) = if r.width >= 0.0 {
(r.x, r.x + r.width)
} else {
(r.x + r.width, r.x)
};
if r.height.abs() <= MAX_RULE_THICKNESS && x2 - x1 > 1.0 {
rules.push(Rule {
x1,
x2,
y: r.y + r.height / 2.0,
});
}
}
rules
}
fn discard_repeated_ruling_rules(rules: Vec<Rule>) -> Vec<Rule> {
if rules.len() < MIN_REPEATED_RULE_LEVELS {
return rules;
}
rules
.iter()
.filter(|rule| {
!is_repeated_ruling_rule(rule, &rules) && !is_segmented_row_ruling_rule(rule, &rules)
})
.cloned()
.collect()
}
fn is_repeated_ruling_rule(rule: &Rule, rules: &[Rule]) -> bool {
let mut y_levels: Vec<f32> = rules
.iter()
.filter(|other| has_similar_span(rule, other))
.map(|other| other.y)
.collect();
y_levels.sort_by(|a, b| a.total_cmp(b));
y_levels.dedup_by(|a, b| (*a - *b).abs() <= RULE_Y_DEDUP_EPS);
y_levels.len() >= MIN_REPEATED_RULE_LEVELS
}
fn is_segmented_row_ruling_rule(rule: &Rule, rules: &[Rule]) -> bool {
let mut row_rules: Vec<&Rule> = rules
.iter()
.filter(|other| (other.y - rule.y).abs() <= RULE_Y_DEDUP_EPS)
.collect();
if row_rules.len() < MIN_SEGMENTED_ROW_RULES {
return false;
}
row_rules.sort_by(|a, b| a.x1.total_cmp(&b.x1));
let large_gaps = row_rules
.windows(2)
.filter(|pair| pair[1].x1 - pair[0].x2 > SEGMENTED_ROW_GAP_MIN)
.count();
large_gaps >= MIN_SEGMENTED_ROW_GAPS
}
fn has_similar_span(a: &Rule, b: &Rule) -> bool {
let a_width = a.width();
let b_width = b.width();
if a_width <= 1.0 || b_width <= 1.0 {
return false;
}
let width_ratio = a_width.max(b_width) / a_width.min(b_width);
if width_ratio > RULE_SPAN_WIDTH_RATIO {
return false;
}
let overlap = a.x2.min(b.x2) - a.x1.max(b.x1);
overlap >= a_width.min(b_width) * RULE_SPAN_OVERLAP_RATIO
}
fn tabular_row_separator_rule_indices(rules: &[Rule], items: &[TextItem]) -> HashSet<usize> {
let mut tabular_rules = HashSet::new();
for (rule_idx, rule) in rules.iter().enumerate() {
let mut matched_items: Vec<&TextItem> = items
.iter()
.filter(|item| is_underline_candidate(item) && rule_matches_item(rule, item))
.collect();
if matched_items.len() < MIN_TABULAR_RULE_ITEMS {
continue;
}
matched_items.sort_by(|a, b| a.x.total_cmp(&b.x));
let large_gaps = matched_items
.windows(2)
.filter(|pair| {
let left = pair[0];
let right = pair[1];
let gap = right.x - (left.x + left.width);
let font_size = left.font_size.max(right.font_size).max(1.0);
gap > font_size * TABULAR_RULE_GAP_EM
})
.count();
if large_gaps >= MIN_TABULAR_RULE_GAPS {
tabular_rules.insert(rule_idx);
}
}
tabular_rules
}
fn is_underline_candidate(item: &TextItem) -> bool {
matches!(item.item_type, ItemType::Text) && !item.text.trim().is_empty() && item.width > 0.0
}
fn rule_matches_item(rule: &Rule, item: &TextItem) -> bool {
// Vertical window: underlines sit at or slightly below the baseline.
// Fonts draw them at roughly 5-15% of the em below; allow up to 35%
// (min 3pt) below and 1pt above for rounding.
let below = (item.font_size * 0.35).max(3.0);
let y_min = item.y - below;
let y_max = item.y + 1.0;
if rule.y < y_min || rule.y > y_max {
return false;
}
let ix1 = item.x;
let ix2 = item.x + item.width;
let min_overlap = item.width * MIN_X_OVERLAP;
let overlap = rule.x2.min(ix2) - rule.x1.max(ix1);
overlap >= min_overlap
}
/// Strikeout window: a rule crossing the glyphs. Strikethroughs sit at
/// roughly 20-35% of the em above the baseline (about half the x-height);
/// accept a band well inside the glyph body so baseline underlines and
/// overlines never qualify.
fn rule_strikes_item(rule: &Rule, item: &TextItem) -> bool {
let y_min = item.y + item.font_size * 0.12;
let y_max = item.y + item.font_size * 0.55;
if rule.y < y_min || rule.y > y_max {
return false;
}
let ix1 = item.x;
let ix2 = item.x + item.width;
let min_overlap = item.width * MIN_X_OVERLAP;
let overlap = rule.x2.min(ix2) - rule.x1.max(ix1);
overlap >= min_overlap
}
/// Mark `is_underline` on text items that have a horizontal rule just
/// below their baseline, and `is_strikeout` on items whose glyphs a rule
/// crosses at mid x-height. `items`, `rects`, and `lines` are a single
/// page's extraction output (all in PDF coordinates, y-up, where
/// `TextItem::y` is the text baseline).
pub(crate) fn mark_underlined_items(
items: &mut [TextItem],
rects: &[PdfRect],
lines: &[UnderlineLine],
page: u32,
) {
let rules = discard_repeated_ruling_rules(rules_from_graphics(rects, lines, page));
if rules.is_empty() {
return;
}
let tabular_rules = tabular_row_separator_rule_indices(&rules, items);
for item in items.iter_mut() {
if !is_underline_candidate(item) {
continue;
}
for (rule_idx, rule) in rules.iter().enumerate() {
if tabular_rules.contains(&rule_idx) {
continue;
}
if rule_matches_item(rule, item) {
item.is_underline = true;
}
if rule_strikes_item(rule, item) {
item.is_strikeout = true;
}
if item.is_underline && item.is_strikeout {
break;
}
}
}
}
#[cfg(test)]
mod tests {
use super::*;
use crate::types::ItemType;
fn item(text: &str, x: f32, y: f32, width: f32, font_size: f32) -> TextItem {
TextItem {
text: text.to_string(),
x,
y,
width,
height: font_size,
font: "F1".to_string(),
font_size,
page: 1,
is_bold: false,
is_italic: false,
is_underline: false,
is_strikeout: false,
item_type: ItemType::Text,
mcid: None,
}
}
fn hline(x1: f32, x2: f32, y: f32) -> UnderlineLine {
UnderlineLine {
x1,
y1: y,
x2,
y2: y,
stroke_width: 1.0,
page: 1,
}
}
fn thin_rect(x: f32, y: f32, width: f32) -> PdfRect {
PdfRect {
x,
y,
width,
height: 0.8,
page: 1,
}
}
#[test]
fn stroked_line_under_baseline_marks_underline() {
let mut items = vec![item("underlined", 100.0, 500.0, 60.0, 10.0)];
let lines = vec![hline(99.0, 161.0, 498.5)];
mark_underlined_items(&mut items, &[], &lines, 1);
assert!(items[0].is_underline);
}
#[test]
fn thin_filled_rect_under_baseline_marks_underline() {
let mut items = vec![item("underlined", 100.0, 500.0, 60.0, 10.0)];
let rects = vec![thin_rect(100.0, 497.8, 60.0)];
mark_underlined_items(&mut items, &rects, &[], 1);
assert!(items[0].is_underline);
}
#[test]
fn long_rule_under_multiple_items_marks_each() {
// One underline drawn under a whole sentence: every overlapped
// item gets the flag.
let mut items = vec![
item("first", 100.0, 500.0, 40.0, 10.0),
item("second", 145.0, 500.0, 50.0, 10.0),
];
let lines = vec![hline(98.0, 200.0, 498.0)];
mark_underlined_items(&mut items, &[], &lines, 1);
assert!(items[0].is_underline);
assert!(items[1].is_underline);
}
#[test]
fn line_far_below_baseline_is_not_an_underline() {
// A horizontal rule 30pt below (section divider) must not mark.
let mut items = vec![item("text", 100.0, 500.0, 60.0, 10.0)];
let lines = vec![hline(90.0, 300.0, 470.0)];
mark_underlined_items(&mut items, &[], &lines, 1);
assert!(!items[0].is_underline);
}
#[test]
fn thick_stroked_line_is_not_an_underline() {
let mut items = vec![item("text", 100.0, 500.0, 60.0, 10.0)];
let mut line = hline(99.0, 161.0, 498.5);
line.stroke_width = 4.0;
mark_underlined_items(&mut items, &[], &[line], 1);
assert!(!items[0].is_underline);
}
#[test]
fn mid_glyph_rule_marks_strikeout_not_underline() {
// Rule at ~30% of the em above the baseline crosses the glyphs.
let mut items = vec![item("struck out", 100.0, 500.0, 60.0, 10.0)];
let lines = vec![hline(99.0, 161.0, 503.0)];
mark_underlined_items(&mut items, &[], &lines, 1);
assert!(items[0].is_strikeout);
assert!(!items[0].is_underline);
}
#[test]
fn baseline_rule_marks_underline_not_strikeout() {
let mut items = vec![item("underlined", 100.0, 500.0, 60.0, 10.0)];
let lines = vec![hline(99.0, 161.0, 498.5)];
mark_underlined_items(&mut items, &[], &lines, 1);
assert!(items[0].is_underline);
assert!(!items[0].is_strikeout);
}
#[test]
fn overline_is_neither_underline_nor_strikeout() {
// Rule just above the cap height (overline / next line's rule).
let mut items = vec![item("text", 100.0, 500.0, 60.0, 10.0)];
let lines = vec![hline(99.0, 161.0, 507.0)];
mark_underlined_items(&mut items, &[], &lines, 1);
assert!(!items[0].is_underline);
assert!(!items[0].is_strikeout);
}
#[test]
fn thin_filled_rect_at_mid_glyph_marks_strikeout() {
let mut items = vec![item("struck out", 100.0, 500.0, 60.0, 10.0)];
let rects = vec![thin_rect(100.0, 502.6, 60.0)];
mark_underlined_items(&mut items, &rects, &[], 1);
assert!(items[0].is_strikeout);
assert!(!items[0].is_underline);
}
#[test]
fn line_above_baseline_is_not_an_underline() {
// Strikethrough / overline geometry must not mark.
let mut items = vec![item("text", 100.0, 500.0, 60.0, 10.0)];
let lines = vec![hline(90.0, 300.0, 505.0)];
mark_underlined_items(&mut items, &[], &lines, 1);
assert!(!items[0].is_underline);
}
#[test]
fn insufficient_horizontal_overlap_is_not_an_underline() {
// Rule under only a quarter of the item (e.g. neighboring cell
// border) must not mark.
let mut items = vec![item("wide text item", 100.0, 500.0, 100.0, 10.0)];
let lines = vec![hline(100.0, 125.0, 498.5)];
mark_underlined_items(&mut items, &[], &lines, 1);
assert!(!items[0].is_underline);
}
#[test]
fn negative_width_rect_is_normalized_and_marks_underline() {
// A CTM with negative x-scale (or negative `re` operands) produces
// rects whose width is negative; the rule extents must normalize.
let mut items = vec![item("underlined", 100.0, 500.0, 60.0, 10.0)];
let rects = vec![PdfRect {
x: 160.0,
y: 497.8,
width: -60.0,
height: 0.8,
page: 1,
}];
mark_underlined_items(&mut items, &rects, &[], 1);
assert!(items[0].is_underline);
}
#[test]
fn negative_height_band_is_not_an_underline() {
// A 14pt band expressed with negative height must not pass the
// thickness check via sign trickery.
let mut items = vec![item("text", 100.0, 500.0, 60.0, 10.0)];
let rects = vec![PdfRect {
x: 95.0,
y: 509.0,
width: 80.0,
height: -14.0,
page: 1,
}];
mark_underlined_items(&mut items, &rects, &[], 1);
assert!(!items[0].is_underline);
}
#[test]
fn thick_band_is_not_an_underline() {
// A highlight bar / filled cell background (tall rect) must not mark.
let mut items = vec![item("text", 100.0, 500.0, 60.0, 10.0)];
let rects = vec![PdfRect {
x: 95.0,
y: 495.0,
width: 80.0,
height: 14.0,
page: 1,
}];
mark_underlined_items(&mut items, &rects, &[], 1);
assert!(!items[0].is_underline);
}
#[test]
fn vertical_line_is_not_an_underline() {
let mut items = vec![item("text", 100.0, 500.0, 60.0, 10.0)];
let lines = vec![UnderlineLine {
x1: 120.0,
y1: 498.0,
x2: 120.0,
y2: 400.0,
stroke_width: 1.0,
page: 1,
}];
mark_underlined_items(&mut items, &[], &lines, 1);
assert!(!items[0].is_underline);
}
#[test]
fn other_pages_graphics_do_not_mark() {
let mut items = vec![item("text", 100.0, 500.0, 60.0, 10.0)];
let mut line = hline(99.0, 161.0, 498.5);
line.page = 2;
mark_underlined_items(&mut items, &[], &[line], 1);
assert!(!items[0].is_underline);
}
#[test]
fn repeated_table_row_rules_do_not_mark_cell_text() {
let mut items = vec![
item("A", 110.0, 500.0, 20.0, 10.0),
item("B", 110.0, 480.0, 20.0, 10.0),
item("C", 110.0, 460.0, 20.0, 10.0),
];
let lines = vec![
hline(100.0, 150.0, 498.0),
hline(100.0, 150.0, 478.0),
hline(100.0, 150.0, 458.0),
];
mark_underlined_items(&mut items, &[], &lines, 1);
assert!(items.iter().all(|item| !item.is_underline));
}
#[test]
fn row_separator_under_spaced_column_labels_is_not_an_underline() {
let mut items = vec![
item("Date", 100.0, 500.0, 25.0, 10.0),
item("Rate", 200.0, 500.0, 25.0, 10.0),
item("Yield", 300.0, 500.0, 30.0, 10.0),
];
let lines = vec![hline(90.0, 340.0, 498.0)];
mark_underlined_items(&mut items, &[], &lines, 1);
assert!(items.iter().all(|item| !item.is_underline));
}
#[test]
fn same_row_spaced_rule_segments_do_not_mark_column_labels() {
let mut items = vec![
item("Date", 100.0, 500.0, 25.0, 10.0),
item("Rate", 200.0, 500.0, 25.0, 10.0),
item("Yield", 300.0, 500.0, 30.0, 10.0),
];
let lines = vec![
hline(98.0, 128.0, 498.0),
hline(198.0, 228.0, 498.0),
hline(298.0, 333.0, 498.0),
];
mark_underlined_items(&mut items, &[], &lines, 1);
assert!(items.iter().all(|item| !item.is_underline));
}
}
+30 -5
View File
@@ -1,5 +1,6 @@
//! Form XObject and image XObject extraction.
use super::fonts::descriptor_style_flags;
use crate::text_utils::{effective_font_size, expand_ligatures, is_bold_font, is_italic_font};
use crate::tounicode::FontCMaps;
use crate::types::{ItemType, TextItem};
@@ -8,7 +9,7 @@ use std::collections::HashMap;
use super::fonts::{
build_font_encodings, build_font_widths, compute_string_width_ts, extract_text_from_operand,
get_font_file2_obj_num, get_operand_bytes, CMapDecisionCache,
get_font_file2_obj_num, get_operand_bytes, CMapDecisionCache, FontStyleCache,
};
use super::{get_number, image_bbox_from_ctm, multiply_matrices};
@@ -114,6 +115,7 @@ pub(crate) fn extract_form_xobject_text(
font_cmaps: &FontCMaps,
parent_ctm: &[f32; 6],
cmap_decisions: &mut CMapDecisionCache,
style_cache: &mut FontStyleCache,
) -> Vec<TextItem> {
extract_form_xobject_text_inner(
doc,
@@ -122,10 +124,12 @@ pub(crate) fn extract_form_xobject_text(
font_cmaps,
parent_ctm,
cmap_decisions,
style_cache,
0,
)
}
#[allow(clippy::too_many_arguments)]
fn extract_form_xobject_text_inner(
doc: &Document,
form_id: ObjectId,
@@ -133,6 +137,7 @@ fn extract_form_xobject_text_inner(
font_cmaps: &FontCMaps,
parent_ctm: &[f32; 6],
cmap_decisions: &mut CMapDecisionCache,
style_cache: &mut FontStyleCache,
depth: u8,
) -> Vec<TextItem> {
use lopdf::content::Content;
@@ -167,6 +172,7 @@ fn extract_form_xobject_text_inner(
let mut font_tounicode_refs: HashMap<String, u32> = HashMap::new();
let mut inline_cmaps: HashMap<String, crate::tounicode::CMapEntry> = HashMap::new();
let mut font_style_flags: HashMap<String, (bool, bool)> = HashMap::new();
for (font_name, font_dict) in &form_fonts {
let resource_name = String::from_utf8_lossy(font_name).to_string();
if let Ok(base_font) = font_dict.get(b"BaseFont") {
@@ -175,6 +181,10 @@ fn extract_form_xobject_text_inner(
font_base_names.insert(resource_name.clone(), base_name);
}
}
let style = descriptor_style_flags(doc, font_dict, style_cache);
if style != (false, false) {
font_style_flags.insert(resource_name.clone(), style);
}
match font_dict.get(b"ToUnicode") {
Ok(tounicode) => {
if let Ok(obj_ref) = tounicode.as_reference() {
@@ -272,6 +282,7 @@ fn extract_form_xobject_text_inner(
font_cmaps,
&ctm,
cmap_decisions,
style_cache,
depth + 1,
);
items.extend(nested_items);
@@ -294,6 +305,8 @@ fn extract_form_xobject_text_inner(
page: page_num,
is_bold: false,
is_italic: false,
is_underline: false,
is_strikeout: false,
item_type: ItemType::Image,
mcid: None,
});
@@ -427,6 +440,10 @@ fn extract_form_xobject_text_inner(
.get(&current_font)
.map(|s| s.as_str())
.unwrap_or(&current_font);
let (desc_italic, desc_bold) = font_style_flags
.get(&current_font)
.copied()
.unwrap_or((false, false));
items.push(TextItem {
text: expand_ligatures(&text),
x,
@@ -436,8 +453,10 @@ fn extract_form_xobject_text_inner(
font: current_font.clone(),
font_size: rendered_size,
page: page_num,
is_bold: is_bold_font(base_font),
is_italic: is_italic_font(base_font),
is_bold: is_bold_font(base_font) || desc_bold,
is_italic: is_italic_font(base_font) || desc_italic,
is_underline: false,
is_strikeout: false,
item_type: ItemType::Text,
mcid: None,
});
@@ -558,6 +577,10 @@ fn extract_form_xobject_text_inner(
.get(&current_font)
.map(|s| s.as_str())
.unwrap_or(&current_font);
let (desc_italic, desc_bold) = font_style_flags
.get(&current_font)
.copied()
.unwrap_or((false, false));
let scale_x = text_matrix[0] * ctm[0] + text_matrix[1] * ctm[2];
for (text, start_w, end_w) in &sub_items {
let offset_tm = [
@@ -584,8 +607,10 @@ fn extract_form_xobject_text_inner(
font: current_font.clone(),
font_size: rendered_size,
page: page_num,
is_bold: is_bold_font(base_font),
is_italic: is_italic_font(base_font),
is_bold: is_bold_font(base_font) || desc_bold,
is_italic: is_italic_font(base_font) || desc_italic,
is_underline: false,
is_strikeout: false,
item_type: ItemType::Text,
mcid: None,
});
+372 -6
View File
@@ -579,6 +579,7 @@ pub fn extract_text_in_regions_mem(
let mut gid_pages: HashSet<u32> = HashSet::new();
let mut page_thresholds: HashMap<u32, f32> = HashMap::new();
let mut rotated_pages: HashSet<u32> = HashSet::new();
let mut style_cache = extractor::FontStyleCache::new();
for (page_num, &page_id) in pages.iter() {
if !needed_pages.contains(page_num) {
@@ -597,6 +598,7 @@ pub fn extract_text_in_regions_mem(
*page_num,
&font_cmaps,
false,
&mut style_cache,
)?;
let threshold = text_utils::fix_letterspaced_items(&mut items);
if threshold > 0.10 {
@@ -699,6 +701,7 @@ pub fn extract_tables_in_regions_mem(
let mut gid_pages: HashSet<u32> = HashSet::new();
let mut page_thresholds: HashMap<u32, f32> = HashMap::new();
let mut rotated_pages: HashSet<u32> = HashSet::new();
let mut style_cache = extractor::FontStyleCache::new();
for (page_num, &page_id) in pages.iter() {
if !needed_pages.contains(page_num) {
@@ -714,6 +717,7 @@ pub fn extract_tables_in_regions_mem(
*page_num,
&font_cmaps,
false,
&mut style_cache,
)?;
let threshold = text_utils::fix_letterspaced_items(&mut items);
if threshold > 0.10 {
@@ -1019,6 +1023,7 @@ pub fn detect_vector_grid_in_region_mem(
page_1idx,
&font_cmaps,
false,
&mut extractor::FontStyleCache::new(),
)?;
text_utils::fix_letterspaced_items(&mut items);
@@ -1205,8 +1210,15 @@ mod vector_grid_tests {
let &page_id = pages.get(&1).unwrap();
let needed: HashSet<u32> = HashSet::from([1]);
let cmaps = FontCMaps::from_doc_pages_fast(&doc, Some(&needed));
let ((items, rects, _lines), _has_gid, _rotated) =
extract_page_text_items(&doc, page_id, 1, &cmaps, false).unwrap();
let ((items, rects, _lines), _has_gid, _rotated) = extract_page_text_items(
&doc,
page_id,
1,
&cmaps,
false,
&mut crate::extractor::FontStyleCache::new(),
)
.unwrap();
let (rect_tables, _) = detect_tables_from_rects(&items, &rects, 1);
assert_eq!(rect_tables.len(), 1, "expected one rect-detected table");
@@ -1240,8 +1252,15 @@ mod vector_grid_tests {
let &page_id = pages.get(&page_num).unwrap();
let needed: HashSet<u32> = HashSet::from([page_num]);
let cmaps = FontCMaps::from_doc_pages_fast(&doc, Some(&needed));
let ((items, rects, _lines), _has_gid, _rotated) =
extract_page_text_items(&doc, page_id, page_num, &cmaps, false).unwrap();
let ((items, rects, _lines), _has_gid, _rotated) = extract_page_text_items(
&doc,
page_id,
page_num,
&cmaps,
false,
&mut crate::extractor::FontStyleCache::new(),
)
.unwrap();
let (rect_tables, _) = detect_tables_from_rects(&items, &rects, page_num);
rect_tables
@@ -1288,6 +1307,19 @@ mod vector_grid_tests {
);
}
#[test]
fn td9264_insurance_prose_not_rect_table() {
let tables = detect_rect_tables_in_fixture_page("tests/fixtures/td9264.pdf", 4);
assert!(
tables.is_empty(),
"expected no rect-detected tables for the insurance-company prose; got {:?}",
tables
.iter()
.map(|t| (t.rows.len(), t.columns.len(), t.cells.clone()))
.collect::<Vec<_>>()
);
}
/// Wireless table regression: decorative/text-region rects may provide row
/// bands, but without a real rect-derived column scaffold they must not be
/// accepted as a vector grid.
@@ -1953,6 +1985,7 @@ pub fn extract_tables_with_structure_cells_mem(
let mut page_heights: HashMap<u32, f32> = HashMap::new();
let mut page_thresholds: HashMap<u32, f32> = HashMap::new();
let mut rotated_pages: HashSet<u32> = HashSet::new();
let mut style_cache = extractor::FontStyleCache::new();
for (page_num, &page_id) in pages.iter() {
if !needed_pages.contains(page_num) {
@@ -1968,6 +2001,7 @@ pub fn extract_tables_with_structure_cells_mem(
*page_num,
&font_cmaps,
false,
&mut style_cache,
)?;
let threshold = text_utils::fix_letterspaced_items(&mut items);
if threshold > 0.10 {
@@ -2769,6 +2803,7 @@ fn detect_tsr_quality_issue(
page_1idx,
&font_cmaps,
false,
&mut extractor::FontStyleCache::new(),
)?;
let adaptive_threshold = text_utils::fix_letterspaced_items(&mut items);
let coords = if coords_rotated {
@@ -3684,7 +3719,14 @@ fn detect_encoding_issues(markdown: &str) -> bool {
}
// Heuristic 2: dollar-as-space pattern
has_dollar_as_space_pattern(markdown)
if has_dollar_as_space_pattern(markdown) {
return true;
}
// Heuristic 3: substitution-cipher letter statistics (broken ToUnicode)
let mut stats = CipherGarbleStats::default();
stats.add_text(markdown);
stats.looks_garbled()
}
fn has_dollar_as_space_pattern(markdown: &str) -> bool {
@@ -3708,6 +3750,156 @@ fn has_dollar_as_space_pattern(markdown: &str) -> bool {
false
}
/// English letter frequencies (percent, az). Used as a natural-language
/// reference: every Latin-script language in the eval corpus (Swedish,
/// Finnish, Turkish, German, romaji) scores ≥ 0.80 cosine similarity against
/// it, while substitution-cipher text scores ~0.53.
const ENGLISH_LETTER_FREQ: [f64; 26] = [
8.2, 1.5, 2.8, 4.3, 12.7, 2.2, 2.0, 6.1, 7.0, 0.15, 0.8, 4.0, 2.4, 6.7, 7.5, 1.9, 0.1, 6.0,
6.3, 9.1, 2.8, 1.0, 2.4, 0.15, 2.0, 0.07,
];
/// Letter statistics for detecting substitution-cipher garbling: broken
/// ToUnicode CMaps that shift every character by a per-range constant (e.g.
/// `Certificate` extracted as `8VceZWZTReV`). Such text is 100% printable
/// ASCII with word-like token lengths, so it defeats `is_garbage_text` and
/// produces no replacement characters — it needs its own discriminator.
#[derive(Debug, Default)]
struct CipherGarbleStats {
/// Case-folded ASCII letter histogram.
letter_counts: [u32; 26],
ascii_letters: usize,
ascii_vowels: usize,
/// Accented Latin letters (Latin-1 Supplement through Latin Extended-B,
/// plus Latin Extended Additional). Count toward Latin dominance only.
latin_ext_letters: usize,
non_latin_letters: usize,
/// Adjacent ASCII-letter pairs, and how many of them switch from
/// lowercase straight to uppercase mid-word.
letter_bigrams: usize,
case_shift_bigrams: usize,
}
impl CipherGarbleStats {
fn add_text(&mut self, text: &str) {
let mut prev: Option<char> = None;
for ch in text.chars() {
if ch.is_ascii_alphabetic() {
let idx = (ch.to_ascii_lowercase() as u8 - b'a') as usize;
self.letter_counts[idx] += 1;
self.ascii_letters += 1;
if matches!(ch.to_ascii_lowercase(), 'a' | 'e' | 'i' | 'o' | 'u') {
self.ascii_vowels += 1;
}
if let Some(p) = prev {
self.letter_bigrams += 1;
if p.is_ascii_lowercase() && ch.is_ascii_uppercase() {
self.case_shift_bigrams += 1;
}
}
prev = Some(ch);
} else {
if ch.is_alphabetic() {
if matches!(ch as u32, 0xC0..=0x24F | 0x1E00..=0x1EFF) {
self.latin_ext_letters += 1;
} else {
self.non_latin_letters += 1;
}
}
prev = None;
}
}
}
/// Cosine similarity between the observed letter histogram and English
/// letter frequencies. A shifted alphabet permutes the histogram, which
/// destroys the similarity regardless of the shift amount.
fn english_cosine(&self) -> f64 {
if self.ascii_letters == 0 {
return 1.0;
}
let n = self.ascii_letters as f64;
let mut dot = 0.0;
let mut norm_obs = 0.0;
for (count, freq) in self.letter_counts.iter().zip(ENGLISH_LETTER_FREQ) {
let p = *count as f64 / n;
dot += p * freq;
norm_obs += p * p;
}
let norm_en = ENGLISH_LETTER_FREQ
.iter()
.map(|f| f * f)
.sum::<f64>()
.sqrt();
dot / (norm_obs.sqrt() * norm_en)
}
/// Cosine similarity between the observed histogram and English
/// frequencies after sorting BOTH descending — i.e. comparing the *shape*
/// of the frequency profile, ignoring which letter sits where. A
/// substitution cipher is a bijection, so it preserves this shape exactly
/// (att10k 0.97, arbitrary shifts 0.99) regardless of case or offset.
/// Non-linguistic ASCII has a different profile: a small alphabet is far
/// steeper (random DNA 0.74, hex dumps 0.81), so the shape diverges.
fn english_shape_cosine(&self) -> f64 {
if self.ascii_letters == 0 {
return 1.0;
}
let n = self.ascii_letters as f64;
let mut obs: [f64; 26] = std::array::from_fn(|i| self.letter_counts[i] as f64 / n);
obs.sort_unstable_by(|a, b| b.total_cmp(a));
let mut en = ENGLISH_LETTER_FREQ;
en.sort_unstable_by(|a, b| b.total_cmp(a));
let dot: f64 = obs.iter().zip(en).map(|(o, e)| o * e).sum();
let norm_obs = obs.iter().map(|o| o * o).sum::<f64>().sqrt();
let norm_en = en.iter().map(|e| e * e).sum::<f64>().sqrt();
dot / (norm_obs * norm_en)
}
/// Thresholds validated against the 380-document pdf-evals snapshot
/// corpus (0 false positives) and the garbled ParseBench `att10k` page
/// (vowel ratio 0.245, case-shift rate 0.225, cosine 0.532). Closest
/// legitimate document on each axis: vowel ratio 0.264 (circuit
/// schematic), case-shift rate 0.021, cosine 0.801.
fn looks_garbled(&self) -> bool {
// Need a statistically meaningful, Latin-dominant sample.
if self.ascii_letters < 200
|| self.non_latin_letters > self.ascii_letters + self.latin_ext_letters
{
return false;
}
// Real Latin-script text keeps vowels above ~30% of letters even in
// acronym- and part-number-heavy documents; shifted text starves them.
let vowel_ratio = self.ascii_vowels as f64 / self.ascii_letters as f64;
if vowel_ratio > 0.30 {
return false;
}
// Signal 1: lowercase→uppercase transitions inside words. A shifted
// lowercase alphabet straddles the ASCII uppercase block ('i'→'Z',
// 't'→'e'), so garbled words flip case constantly. Real documents
// stay ≤ 0.02 even with camelCase identifiers.
let case_shifts = self.letter_bigrams >= 100
&& self.case_shift_bigrams as f64 >= self.letter_bigrams as f64 * 0.10;
// Signal 2: the histogram is a permutation of natural language — an
// English-like frequency SHAPE (sorted cosine high) but with letters
// in the wrong POSITIONS (unsorted cosine low). This is the signature
// of a substitution cipher and is case-independent, so it catches
// all-lowercase and all-uppercase shifts as well as case-straddling
// ones. Genuinely non-linguistic ASCII that is merely "unlike English"
// fails one of the two halves: DNA/hex dumps have too steep a profile
// (shape cosine < 0.90), while protein sequences, ticker symbols and
// base64 are not sufficiently unlike English in position (unsorted
// cosine ≥ 0.60) — so none of them are routed to OCR.
let permuted_language = self.english_cosine() < 0.60 && self.english_shape_cosine() >= 0.90;
case_shifts || permuted_language
}
}
#[derive(Debug, Default)]
struct TextQualityReport {
pages_needing_ocr: Vec<u32>,
@@ -3721,6 +3913,7 @@ struct PageTextQualityEvidence {
replacement_chars: usize,
replacement_spans: usize,
longest_replacement_run: usize,
cipher_garble: CipherGarbleStats,
}
#[derive(Debug, Clone, Copy, PartialEq, Eq)]
@@ -3740,6 +3933,7 @@ fn analyze_text_quality(items: &[TextItem]) -> TextQualityReport {
let evidence = evidence_by_page.entry(item.page).or_default();
evidence.chars += item.text.chars().filter(|ch| !ch.is_whitespace()).count();
evidence.cipher_garble.add_text(&item.text);
match text_span_decoding_issue_kind(&item.text) {
Some(TextSpanIssueKind::Strong) => {
@@ -3763,7 +3957,8 @@ fn analyze_text_quality(items: &[TextItem]) -> TextQualityReport {
if reasons_by_page.contains_key(&page) {
continue;
}
if page_replacement_evidence_needs_ocr(&evidence) {
if page_replacement_evidence_needs_ocr(&evidence) || evidence.cipher_garble.looks_garbled()
{
add_ocr_reason(
&mut reasons_by_page,
page,
@@ -4882,6 +5077,8 @@ mod text_cluster_column_undercount_tests {
page: 1,
is_bold: false,
is_italic: false,
is_underline: false,
is_strikeout: false,
item_type: ItemType::Text,
mcid: None,
}
@@ -5156,6 +5353,8 @@ mod table_candidate_selection_tests {
page: 1,
is_bold: false,
is_italic: false,
is_underline: false,
is_strikeout: false,
item_type: ItemType::Text,
mcid: None,
}
@@ -5902,6 +6101,8 @@ mod tests {
page: 1,
is_bold: false,
is_italic: false,
is_underline: false,
is_strikeout: false,
item_type: ItemType::Text,
mcid: None,
}
@@ -5949,6 +6150,171 @@ mod tests {
assert!(!detect_encoding_issues(text));
}
/// Real garbled output from ParseBench `text_simple__att10k.pdf`: a broken
/// ToUnicode CMap shifts every character by a per-range constant, so
/// "Certificate of Designations with respect to Series C" extracts as
/// pure-ASCII ciphertext (issue #118).
const SHIFTED_CIPHER_TEXT: &str =
"8VceZWZTReVW9VdZXReZdhZeYcVdaVTeeHVcZVd8EcVWVccVUHeT:iYZSZe-(,e2'WZ]V \
;VScfRcj2&,*,*$ .'R CZdecfVehYZTYUVWZVdeYVcZXYedWY]UVcdW]X'eVcUVSeYVcVXZdecReRUR]]ed \
TCBGC@ZUReVUdfSdZUZRcZVdZdWZ]VUYVcVhZeYafcdfReeVXf]ReZV0*S$.$ZZZ$6$&ViTVae \
WceYVZdecfVedcVWVccVUe.'S&.'T&.'U&.'V&.'WSV]h(EfcdfReeYZdcVXf]ReZYV \
cVXZdecReYVcVSjRXcVVdeWfcZdYRTajWRjdfTYZdecfVeWZ]VUYVcVhZeYeYVH:8 \
cVbfVde( .'S fRcRejWTVceRZZXReZTZWZT7V]]IV]VaYV8(RUHfeYhVdeVc7V]]IV]VaYV8 \
:iYZSZe.'TeYVaVcZUVUZX9VTVSVc-&,*$";
#[test]
fn test_detect_encoding_issues_shifted_cipher_text() {
assert!(detect_encoding_issues(SHIFTED_CIPHER_TEXT));
}
#[test]
fn test_shifted_cipher_below_sample_threshold_not_flagged() {
// Fewer than 200 ASCII letters: not enough evidence to condemn.
assert!(!detect_encoding_issues("8VceZWZTReVW9VdZXReZdhZeY"));
}
#[test]
fn test_clean_prose_not_flagged_as_cipher() {
let prose = "Certificate of Designations with respect to Series C Preferred Stock, \
filed February 18, 2020. No instrument which defines the rights of holders of \
long-term debt of the registrant and all of its consolidated subsidiaries is \
filed herewith pursuant to Regulation S-K, Item 601. Pursuant to this regulation, \
the registrant hereby agrees to furnish a copy of any such instrument to the SEC \
upon request.";
assert!(!detect_encoding_issues(prose));
}
#[test]
fn test_camel_case_code_not_flagged_as_cipher() {
let code = "The getElementById and querySelectorAll methods return DOM nodes. Use \
addEventListener with removeEventListener, requestAnimationFrame with \
cancelAnimationFrame, and setTimeout with clearTimeout. The XMLHttpRequest \
object exposes onreadystatechange, responseText and getAllResponseHeaders. \
Prefer createElement, appendChild, insertBefore and replaceChild for DOM \
manipulation, and getBoundingClientRect for layout measurement.";
assert!(!detect_encoding_issues(code));
}
#[test]
fn test_accented_european_text_not_flagged_as_cipher() {
let swedish = "Regeringen föreslår att riksdagen antar förslaget till lag om ändring \
i skatteförfarandelagen. Bestämmelserna föreslås träda i kraft den första januari. \
Förslaget innebär att företag med säte i utlandet måste lämna särskilda uppgifter \
till Skatteverket varje kvartal, och att avgiften höjs för överträdelser av de nya \
bestämmelserna om rapporteringsskyldighet för gränsöverskridande arrangemang.";
assert!(!detect_encoding_issues(swedish));
}
#[test]
fn test_all_caps_text_not_flagged_as_cipher() {
let caps = "EXHIBIT INDEX PURSUANT TO ITEM 601 OF REGULATION SK CERTIFICATE OF \
DESIGNATIONS WITH RESPECT TO SERIES C PREFERRED STOCK FILED FEBRUARY EIGHTEEN \
TWENTY TWENTY AND INCORPORATED HEREIN BY REFERENCE TO THE ANNUAL REPORT ON FORM \
TENK FOR THE PERIOD ENDED DECEMBER THIRTYFIRST TWENTY NINETEEN AS AMENDED";
assert!(!detect_encoding_issues(caps));
}
// A Caesar shift of prose that stays within a single case block does not
// trigger the case-shift signal, but it permutes the letter histogram: the
// frequency SHAPE stays English-like while letter POSITIONS scramble, so
// the permutation signal catches it regardless of case.
const CAESAR_PROSE: &str =
"The registrant hereby agrees to furnish a copy of any such instrument to the \
Commission upon request. This certificate of designations was filed February with \
respect to Series Preferred Stock and incorporated herein by reference to the annual \
report on form for the period ended December as amended and restated thereafter.";
fn caesar_shift(text: &str, k: u8) -> String {
text.chars()
.map(|c| match c {
'a'..='z' => (((c as u8 - b'a' + k) % 26) + b'a') as char,
'A'..='Z' => (((c as u8 - b'A' + k) % 26) + b'A') as char,
_ => c,
})
.collect()
}
#[test]
fn test_mixed_case_caesar_shift_flagged() {
assert!(detect_encoding_issues(&caesar_shift(CAESAR_PROSE, 3)));
}
#[test]
fn test_all_lowercase_caesar_shift_flagged() {
// Uniform all-lowercase garbled prose: the earlier mixed-case guard
// would have exempted this, so it must be caught by the case-agnostic
// permutation signal instead.
assert!(detect_encoding_issues(&caesar_shift(
&CAESAR_PROSE.to_lowercase(),
5
)));
}
#[test]
fn test_all_uppercase_caesar_shift_flagged() {
assert!(detect_encoding_issues(&caesar_shift(
&CAESAR_PROSE.to_uppercase(),
7
)));
}
#[test]
fn test_dna_sequence_not_flagged_as_cipher() {
// Non-linguistic ASCII: unlike English (low vowel ratio, low cosine)
// but not garbled. Its 4-letter alphabet makes the frequency profile
// too steep, so the shape cosine falls below the permutation threshold.
let dna = "ACGT".repeat(120);
assert!(!detect_encoding_issues(&dna));
}
#[test]
fn test_protein_sequence_not_flagged_as_cipher() {
let protein =
"MKTAYIAKQRQISFVKSHFSRQLEERLGLIEVQAPILSRVGDGTQDNLSGAEKAVQVKVKALPDAQFEVVHSLAKWKR"
.repeat(6);
assert!(!detect_encoding_issues(&protein));
}
#[test]
fn test_ticker_list_not_flagged_as_cipher() {
let tickers = "AAPL MSFT GOOG TSLA NVDA AMZN META NFLX AMD INTC CSCO ORCL CRM ADBE QCOM \
TXN AVGO MU LRCX KLAC ASML SNPS CDNS FTNT PANW "
.repeat(4);
assert!(!detect_encoding_issues(&tickers));
}
#[test]
fn test_text_quality_flags_shifted_cipher_page() {
let items = vec![
test_text_item_on_page(1, SHIFTED_CIPHER_TEXT),
test_text_item_on_page(2, "A clean second page should not be routed to OCR."),
];
let quality = analyze_text_quality(&items);
assert!(quality.has_encoding_issues);
assert_eq!(quality.pages_needing_ocr, vec![1]);
assert_eq!(
quality.reasons_by_page.get(&1).cloned(),
Some(vec![OCR_REASON_SUSPECTED_GARBLED_TEXT.to_string()])
);
}
#[test]
fn test_text_quality_cipher_stats_accumulate_across_items() {
// The garbled page arrives as many short spans; no single span has
// enough letters to flag on its own.
let items: Vec<TextItem> = SHIFTED_CIPHER_TEXT
.split_whitespace()
.map(|chunk| test_text_item_on_page(1, chunk))
.collect();
let quality = analyze_text_quality(&items);
assert_eq!(quality.pages_needing_ocr, vec![1]);
}
#[test]
fn test_text_quality_flags_localized_cid_mojibake_span() {
let items = vec![
+12 -4
View File
@@ -131,10 +131,11 @@ pub(crate) fn format_list_item(text: &str) -> String {
if let Some(rest) = trimmed.strip_prefix(*bullet) {
return format!("- {}", rest.trim_start());
}
// Bullet inside a leading bold/italic run (e.g. "**● Label:** rest").
// The run wraps both the marker and the following label because both
// use a bold font in the PDF.
for wrapper in ["**", "*"] {
// Bullet inside a leading style run (e.g. "**● Label:** rest" or
// "<u>● Label</u>"). The run wraps both the marker and the following
// label because both carry the style in the PDF. The marker must move
// outside the wrapper so markdown still sees a list item.
for wrapper in ["**", "*", "<u>"] {
if let Some(after_open) = trimmed.strip_prefix(wrapper) {
if let Some(rest) = after_open.strip_prefix(*bullet) {
return format!("- {}{}", wrapper, rest.trim_start());
@@ -235,6 +236,13 @@ mod tests {
assert_eq!(format_list_item("• Item"), "- Item");
}
#[test]
fn format_list_item_bullet_inside_underline() {
// Fully-underlined bullet line: the marker must move outside the
// <u> wrapper so markdown still renders a list item.
assert_eq!(format_list_item("<u>● Item text</u>"), "- <u>Item text</u>");
}
#[test]
fn format_list_item_bullet_inside_bold() {
// PDF that uses bold font for both the marker and the label produces
+27 -6
View File
@@ -625,7 +625,11 @@ pub(super) fn to_markdown_from_lines_with_tables_and_images(
prev_x = line_x;
// Get text with optional bold/italic formatting
let text = line.text_with_formatting(options.detect_bold, options.detect_italic);
let text = line.text_with_formatting(
options.detect_bold,
options.detect_italic,
options.detect_underline,
);
let trimmed = text.trim();
// Also get plain text for pattern matching (list detection, captions, etc.)
@@ -751,8 +755,14 @@ pub(super) fn to_markdown_from_lines_with_tables_and_images(
paragraph_in_wrapped_bold_run = false;
}
let prefix = "#".repeat(level);
// Use plain text for headers to avoid redundant formatting
output.push_str(&format!("{} {}\n\n", prefix, plain_trimmed));
// Plain text for headers (no redundant bold/italic inside `#`),
// but underline is preserved: `<u>` carries meaning `#` doesn't.
let heading_text = if options.detect_underline {
line.text_with_formatting(false, false, true)
} else {
plain_text.clone()
};
output.push_str(&format!("{} {}\n\n", prefix, heading_text.trim()));
in_list = false;
continue;
}
@@ -994,7 +1004,11 @@ pub fn to_markdown_from_lines(lines: Vec<TextLine>, options: MarkdownOptions) ->
prev_y = line.y;
// Get text with optional bold/italic formatting
let text = line.text_with_formatting(options.detect_bold, options.detect_italic);
let text = line.text_with_formatting(
options.detect_bold,
options.detect_italic,
options.detect_underline,
);
let trimmed = text.trim();
// Also get plain text for pattern matching
@@ -1057,8 +1071,13 @@ pub fn to_markdown_from_lines(lines: Vec<TextLine>, options: MarkdownOptions) ->
paragraph_in_wrapped_bold_run = false;
}
let prefix = "#".repeat(header_level);
// Use plain text for headers to avoid redundant formatting
output.push_str(&format!("{} {}\n\n", prefix, plain_trimmed));
// Plain text for headers, except underline (see above).
let heading_text = if options.detect_underline {
line.text_with_formatting(false, false, true)
} else {
plain_text.clone()
};
output.push_str(&format!("{} {}\n\n", prefix, heading_text.trim()));
in_list = false;
continue;
}
@@ -1169,6 +1188,8 @@ mod tests {
page,
is_bold: false,
is_italic: false,
is_underline: false,
is_strikeout: false,
item_type: crate::types::ItemType::Text,
mcid,
}
+5
View File
@@ -400,6 +400,8 @@ pub struct MarkdownOptions {
pub detect_bold: bool,
/// Detect and format italic text from font names
pub detect_italic: bool,
/// Emit `<u>` runs for text with a geometrically-detected underline
pub detect_underline: bool,
/// Include image placeholders in output
pub include_images: bool,
/// Include extracted hyperlinks
@@ -422,6 +424,7 @@ impl Default for MarkdownOptions {
fix_hyphenation: true,
detect_bold: true,
detect_italic: true,
detect_underline: true,
// `include_images: false` is intentional. The content-stream walker
// now emits `ItemType::Image` `TextItem`s for every Image XObject
// it encounters (see `extractor/content_stream.rs`). If we rendered
@@ -1217,6 +1220,8 @@ mod tests {
page,
is_bold: false,
is_italic: false,
is_underline: false,
is_strikeout: false,
item_type: crate::types::ItemType::Text,
mcid: None,
}
+57
View File
@@ -30,6 +30,7 @@ pub(crate) fn clean_markdown(mut text: String, options: &MarkdownOptions) -> Str
// double spaces ("Vice President" instead of "Vice President").
collapse_consecutive_spaces(&mut text);
remove_spaces_before_closing_brackets(&mut text);
remove_spaces_before_sentence_punctuation(&mut text);
// Remove excessive newlines (more than 2 in a row)
while text.contains("\n\n\n") {
@@ -86,6 +87,32 @@ fn remove_spaces_before_closing_brackets(text: &mut String) {
*text = result;
}
/// Remove a stray space before sentence punctuation ("word ." → "word.").
/// Style-boundary item splits (bold/italic/underline runs) can strand a
/// trailing period or comma in its own fragment, and several assembly paths
/// join fragments with spaces. Only fires when the punctuation ends the
/// token (followed by whitespace or end of text), so decimals ("3 .14" stays
/// untouched — no such input exists, but the guard is cheap) and dot leaders
/// (" ... ") are unaffected.
fn remove_spaces_before_sentence_punctuation(text: &mut String) {
let chars: Vec<char> = text.chars().collect();
let mut result = String::with_capacity(text.len());
for (i, &ch) in chars.iter().enumerate() {
if matches!(ch, '.' | ',' | ';') && result.ends_with(' ') {
let next = chars.get(i + 1);
// `|` counts as a token end so table cells get the same fix.
let token_ends = next.is_none_or(|c| c.is_whitespace() || *c == '|');
// Never touch runs of dots (ellipsis / dot leaders).
let in_dot_run = ch == '.' && next == Some(&'.');
if token_ends && !in_dot_run {
result.pop();
}
}
result.push(ch);
}
*text = result;
}
/// Collapse dot leaders (runs of 4+ dots) into " ... "
/// Common in tables of contents: "Introduction...............................1" -> "Introduction ... 1"
fn collapse_dot_leaders(text: &str) -> String {
@@ -369,6 +396,36 @@ mod tests {
);
}
// --- remove_spaces_before_sentence_punctuation ---
#[test]
fn strips_space_before_trailing_period() {
let mut t = "Foreign insurance companies . The provisions".to_string();
remove_spaces_before_sentence_punctuation(&mut t);
assert_eq!(t, "Foreign insurance companies. The provisions");
}
#[test]
fn strips_space_before_period_at_cell_boundary() {
let mut t = "|Applicability date .|This section|".to_string();
remove_spaces_before_sentence_punctuation(&mut t);
assert_eq!(t, "|Applicability date.|This section|");
}
#[test]
fn keeps_dot_leaders_and_ellipses() {
let mut t = "Introduction ... 1".to_string();
remove_spaces_before_sentence_punctuation(&mut t);
assert_eq!(t, "Introduction ... 1");
}
#[test]
fn keeps_mid_token_periods() {
let mut t = "version 3 .14 released".to_string();
remove_spaces_before_sentence_punctuation(&mut t);
assert_eq!(t, "version 3 .14 released");
}
// --- fix_hyphenation ---
#[test]
+2
View File
@@ -542,6 +542,8 @@ mod tests {
page: 1,
is_bold: false,
is_italic: false,
is_underline: false,
is_strikeout: false,
item_type: ItemType::Text,
mcid,
}
+6
View File
@@ -266,6 +266,10 @@ pub struct PyTextItem {
#[pyo3(get)]
pub is_italic: bool,
#[pyo3(get)]
pub is_underline: bool,
#[pyo3(get)]
pub is_strikeout: bool,
#[pyo3(get)]
pub item_type: String,
}
@@ -349,6 +353,8 @@ fn convert_text_items(items: Vec<crate::TextItem>) -> Vec<PyTextItem> {
page: item.page,
is_bold: item.is_bold,
is_italic: item.is_italic,
is_underline: item.is_underline,
is_strikeout: item.is_strikeout,
item_type: item_type_str(&item.item_type),
})
.collect()
+2
View File
@@ -104,6 +104,8 @@ pub(crate) fn merge_adjacent_items(items: &[TextItem]) -> (Vec<TextItem>, Vec<Ve
page: first_item.page,
is_bold: first_item.is_bold,
is_italic: first_item.is_italic,
is_underline: first_item.is_underline,
is_strikeout: first_item.is_strikeout,
item_type: first_item.item_type.clone(),
mcid: first_item.mcid,
});
+2
View File
@@ -393,6 +393,8 @@ mod tests {
page,
is_bold: false,
is_italic: false,
is_underline: false,
is_strikeout: false,
item_type: ItemType::Text,
mcid: None,
}
+99 -1
View File
@@ -1124,12 +1124,13 @@ pub(crate) fn assign_items_to_grid(
.unwrap_or(std::cmp::Ordering::Equal)
})
});
let text: String = col_items
let text = col_items
.iter()
.map(|(_, item)| item.text.trim())
.filter(|t| !t.is_empty())
.collect::<Vec<_>>()
.join(" ");
let text = remove_inner_delimiter_spaces(&text);
row_cells.push(text);
}
cells.push(row_cells);
@@ -1138,6 +1139,27 @@ pub(crate) fn assign_items_to_grid(
(cells, indices)
}
fn remove_inner_delimiter_spaces(text: &str) -> String {
let chars: Vec<char> = text.chars().collect();
let mut result = String::with_capacity(text.len());
for (i, &ch) in chars.iter().enumerate() {
if ch == ' ' {
let after_open =
result.ends_with('(') || result.ends_with('[') || result.ends_with('{');
let before_close = chars
.get(i + 1)
.is_some_and(|next| matches!(next, ')' | ']' | '}'));
if after_open || before_close {
continue;
}
}
result.push(ch);
}
result
}
/// Consolidate text in vertically-merged cells.
///
/// When a single rect spans multiple grid rows (e.g. a "Classification" label
@@ -1451,6 +1473,10 @@ fn detect_row_stripe_table(
(col_edges, cells)
};
let num_cols = col_edges.len() - 1;
if row_stripe_is_sparse_prose_outline(&cells) {
debug!(" row-stripe rejected: sparse outline/prose continuation shape");
return None;
}
let column_centers: Vec<f32> = (0..num_cols)
.map(|c| (col_edges[c] + col_edges[c + 1]) / 2.0)
@@ -1469,6 +1495,57 @@ fn detect_row_stripe_table(
Some(Table::new(column_centers, row_centers, cells, item_indices))
}
fn row_stripe_is_sparse_prose_outline(cells: &[Vec<String>]) -> bool {
let Some(num_cols) = cells.first().map(|row| row.len()) else {
return false;
};
if num_cols != 2 || cells.len() < 4 {
return false;
}
let non_empty_rows = cells
.iter()
.filter(|row| row.iter().any(|cell| !cell.trim().is_empty()))
.count();
if non_empty_rows < 4 {
return false;
}
let mut col_counts = [0usize; 2];
for row in cells {
for (idx, cell) in row.iter().enumerate() {
if !cell.trim().is_empty() {
col_counts[idx] += 1;
}
}
}
let (sparse_col, dense_col) = if col_counts[0] <= col_counts[1] {
(0usize, 1usize)
} else {
(1usize, 0usize)
};
let sparse_count = col_counts[sparse_col];
let dense_count = col_counts[dense_col];
if sparse_count * 2 >= non_empty_rows || dense_count * 3 < non_empty_rows * 2 {
return false;
}
let blank_sparse_dense_rows = cells
.iter()
.filter(|row| row[sparse_col].trim().is_empty() && !row[dense_col].trim().is_empty())
.count();
if blank_sparse_dense_rows * 2 < non_empty_rows {
return false;
}
let long_dense_cells = cells
.iter()
.filter(|row| row[dense_col].split_whitespace().count() >= 6)
.count();
long_dense_cells * 2 >= dense_count
}
/// Detect a table from cell-background rects that failed grid detection.
///
/// Uses rect Y-edges for row boundaries and text X-position clustering for
@@ -2314,6 +2391,8 @@ mod tests {
page: 1,
is_bold: false,
is_italic: false,
is_underline: false,
is_strikeout: false,
item_type: ItemType::Text,
mcid: None,
}
@@ -2523,6 +2602,21 @@ mod tests {
assert!(cells[0][0].contains("World"));
}
#[test]
fn test_assign_items_parenthetical_no_inner_spaces() {
let items = vec![
make_item("The first sentence", 15.0, 85.0, 10.0),
make_item("(", 90.0, 85.0, 10.0),
make_item("twice", 95.0, 85.0, 10.0),
make_item(")", 120.0, 85.0, 10.0),
];
let col_edges = vec![10.0, 150.0];
let row_edges = vec![90.0, 70.0];
let (cells, indices) = assign_items_to_grid(&items, &col_edges, &row_edges, 1);
assert_eq!(indices.len(), 4);
assert_eq!(cells[0][0], "The first sentence (twice)");
}
#[test]
fn test_assign_items_boundary_tolerance() {
// Item right at edge with ±2pt tolerance
@@ -3272,6 +3366,8 @@ mod tests {
page: 1,
is_bold: false,
is_italic: false,
is_underline: false,
is_strikeout: false,
item_type: crate::types::ItemType::Text,
mcid: None,
});
@@ -3581,6 +3677,8 @@ mod tests {
page: 1,
is_bold: false,
is_italic: false,
is_underline: false,
is_strikeout: false,
item_type: crate::types::ItemType::Text,
mcid: None,
});
+2
View File
@@ -586,6 +586,8 @@ mod tests {
page,
is_bold: false,
is_italic: false,
is_underline: false,
is_strikeout: false,
item_type: ItemType::Text,
mcid,
}
+2
View File
@@ -108,6 +108,8 @@ pub(crate) fn try_split_financial_item(item: &TextItem) -> Option<Vec<TextItem>>
page: item.page,
is_bold: item.is_bold,
is_italic: item.is_italic,
is_underline: item.is_underline,
is_strikeout: item.is_strikeout,
item_type: item.item_type.clone(),
mcid: item.mcid,
});
+24
View File
@@ -369,6 +369,10 @@ pub(crate) fn join_cell_items(items: &[&TextItem]) -> String {
let prev_ends_with_hyphen = result.ends_with('-');
let curr_is_hyphen = text == "-";
let curr_starts_with_hyphen = text.starts_with('-');
let prev_ends_with_open_delimiter =
result.ends_with('(') || result.ends_with('[') || result.ends_with('{');
let curr_starts_with_close_delimiter =
text.starts_with(')') || text.starts_with(']') || text.starts_with('}');
// Detect subscript/superscript: smaller font size and/or Y offset
let font_ratio = item.font_size / prev_item.font_size;
@@ -385,6 +389,8 @@ pub(crate) fn join_cell_items(items: &[&TextItem]) -> String {
|| curr_starts_with_hyphen
|| is_sub_super
|| was_sub_super
|| prev_ends_with_open_delimiter
|| curr_starts_with_close_delimiter
{
result.push_str(text);
} else {
@@ -514,6 +520,8 @@ mod tests {
page: 1,
is_bold: false,
is_italic: false,
is_underline: false,
is_strikeout: false,
item_type: ItemType::Text,
mcid: None,
}
@@ -727,6 +735,18 @@ mod tests {
assert_eq!(join_cell_items(&[&a, &b, &c]), "pre-fix");
}
#[test]
fn test_join_cell_items_parenthetical_no_inner_spaces() {
let a = make_item("The first sentence", 100.0, 500.0, 10.0);
let b = make_item("(", 190.0, 500.0, 10.0);
let c = make_item("twice", 195.0, 500.0, 10.0);
let d = make_item(")", 220.0, 500.0, 10.0);
assert_eq!(
join_cell_items(&[&a, &b, &c, &d]),
"The first sentence (twice)"
);
}
#[test]
fn test_join_cell_items_subscript_no_space() {
let a = make_item("H", 100.0, 500.0, 12.0);
@@ -866,6 +886,8 @@ mod tests {
font: String::new(),
is_bold: false,
is_italic: false,
is_underline: false,
is_strikeout: false,
item_type: ItemType::Text,
mcid: None,
page: 1,
@@ -902,6 +924,8 @@ mod tests {
font: String::new(),
is_bold: false,
is_italic: false,
is_underline: false,
is_strikeout: false,
item_type: ItemType::Text,
mcid: None,
page: 1,
+8
View File
@@ -235,6 +235,8 @@ fn split_merged_numbers(item: &TextItem, col_boundaries: &[f32]) -> Vec<TextItem
page: item.page,
is_bold: item.is_bold,
is_italic: item.is_italic,
is_underline: item.is_underline,
is_strikeout: item.is_strikeout,
item_type: item.item_type.clone(),
mcid: item.mcid,
});
@@ -255,6 +257,8 @@ fn split_merged_numbers(item: &TextItem, col_boundaries: &[f32]) -> Vec<TextItem
page: item.page,
is_bold: item.is_bold,
is_italic: item.is_italic,
is_underline: item.is_underline,
is_strikeout: item.is_strikeout,
item_type: item.item_type.clone(),
mcid: item.mcid,
});
@@ -1429,6 +1433,8 @@ mod tests {
page: 1,
is_bold: false,
is_italic: false,
is_underline: false,
is_strikeout: false,
item_type: ItemType::Text,
mcid: None,
}
@@ -1446,6 +1452,8 @@ mod tests {
page: 1,
is_bold: false,
is_italic: false,
is_underline: false,
is_strikeout: false,
item_type: ItemType::Text,
mcid: None,
}
+20
View File
@@ -93,6 +93,9 @@ pub fn is_bold_font(font_name: &str) -> bool {
|| lower.contains("extrabold")
|| lower.contains("ultrabold")
|| lower.contains("medium") && !lower.contains("mediumitalic") // Some fonts use Medium for semi-bold
// URW Type 1 fonts abbreviate Medium as "Medi" (e.g. NimbusRomNo9L-Medi,
// the Times-Bold substitute in LaTeX documents; -MediItal is bold italic).
|| lower.contains("-medi") && !lower.contains("mediumital")
}
/// Detect if a font name indicates italic/oblique style
@@ -762,6 +765,17 @@ mod tests {
use super::*;
use crate::types::ItemType;
#[test]
fn bold_font_urw_medi_abbreviation() {
// URW Type 1 fonts (LaTeX default Times) abbreviate Medium as "Medi"
assert!(is_bold_font("NROFIU+NimbusRomNo9L-Medi"));
assert!(is_bold_font("NimbusRomNo9L-MediItal"));
assert!(!is_bold_font("DSSZWN+NimbusRomNo9L-Regu"));
assert!(!is_bold_font("NimbusRomNo9L-ReguItal"));
// Medium-Italic exclusion still holds
assert!(!is_bold_font("Foo-MediumItalic"));
}
#[test]
fn strip_soft_hyphen() {
assert_eq!(expand_ligatures("con\u{00AD}tent"), "content");
@@ -883,6 +897,8 @@ mod tests {
page: 1,
is_bold: false,
is_italic: false,
is_underline: false,
is_strikeout: false,
item_type: ItemType::Text,
mcid: None,
}
@@ -1002,6 +1018,8 @@ mod tests {
page: 1,
is_bold: false,
is_italic: false,
is_underline: false,
is_strikeout: false,
item_type: ItemType::Text,
mcid: None,
});
@@ -1078,6 +1096,8 @@ mod tests {
page: 1,
is_bold: false,
is_italic: false,
is_underline: false,
is_strikeout: false,
item_type: ItemType::Text,
mcid: None,
}
+36 -7
View File
@@ -116,6 +116,14 @@ pub struct TextItem {
pub is_bold: bool,
/// Whether the font is italic
pub is_italic: bool,
/// Whether the text is underlined (drawn rule/thin rect under the
/// baseline — PDFs have no underline font flag, so this is detected
/// geometrically after extraction; see `extractor::underline`).
pub is_underline: bool,
/// Whether the text is struck out (drawn rule/thin rect crossing the
/// glyphs at mid x-height). Same geometric detection as underline,
/// different vertical window; see `extractor::underline`.
pub is_strikeout: bool,
/// Type of item (text, image, link)
pub item_type: ItemType,
/// Marked Content ID from the content stream's BDC/BMC operator.
@@ -137,12 +145,17 @@ pub struct TextLine {
impl TextLine {
pub fn text(&self) -> String {
self.text_with_formatting(false, false)
self.text_with_formatting(false, false, false)
}
/// Get text with optional bold/italic markdown formatting
pub fn text_with_formatting(&self, format_bold: bool, format_italic: bool) -> String {
if !format_bold && !format_italic {
/// Get text with optional bold/italic/underline markdown formatting
pub fn text_with_formatting(
&self,
format_bold: bool,
format_italic: bool,
format_underline: bool,
) -> String {
if !format_bold && !format_italic && !format_underline {
return self.text_plain();
}
@@ -151,6 +164,7 @@ impl TextLine {
let mut result = String::new();
let mut current_bold = false;
let mut current_italic = false;
let mut current_underline = false;
for (i, item) in self.items.iter().enumerate() {
let text = item.text.as_str();
@@ -176,9 +190,13 @@ impl TextLine {
// we push text_trimmed below (which strips it).
let has_leading_space = text.starts_with(' ');
// Check for style changes
let item_bold = format_bold && item.is_bold;
let item_italic = format_italic && item.is_italic;
// Check for style changes. Underline is exclusive: `<u>` content
// stays free of `**`/`*` markers — consumers (and the eval
// harnesses this feeds) match the tag content literally, and
// mixed `<u>**x**</u>` nesting breaks that.
let item_underline = format_underline && item.is_underline;
let item_bold = format_bold && item.is_bold && !item_underline;
let item_italic = format_italic && item.is_italic && !item_underline;
// Close previous styles if they change
if current_italic && !item_italic {
@@ -189,6 +207,10 @@ impl TextLine {
result.push_str("**");
current_bold = false;
}
if current_underline && !item_underline {
result.push_str("</u>");
current_underline = false;
}
// Add space: either from spacing logic or preserved from item text
if needs_space || (has_leading_space && !result.is_empty() && !result.ends_with(' ')) {
@@ -196,6 +218,10 @@ impl TextLine {
}
// Open new styles
if item_underline && !current_underline {
result.push_str("<u>");
current_underline = true;
}
if item_bold && !current_bold {
result.push_str("**");
current_bold = true;
@@ -215,6 +241,9 @@ impl TextLine {
if current_bold {
result.push_str("**");
}
if current_underline {
result.push_str("</u>");
}
result
}
Binary file not shown.
+30
View File
@@ -104,6 +104,8 @@ fn make_text_item(text: &str, x: f32, y: f32, font_size: f32, page: u32) -> Text
page,
is_bold: false,
is_italic: false,
is_underline: false,
is_strikeout: false,
item_type: ItemType::Text,
mcid: None,
}
@@ -129,6 +131,8 @@ fn make_text_item_with_font(
page,
is_bold: is_bold_font(font),
is_italic: is_italic_font(font),
is_underline: false,
is_strikeout: false,
item_type: ItemType::Text,
mcid: None,
}
@@ -1354,6 +1358,32 @@ fn test_extract_regions_mem_identity_h_needs_ocr() {
);
}
/// ParseBench `text_simple__att10k.pdf` (issue #118): the producer authored a
/// broken ToUnicode CMap that shifts every character by a per-range constant,
/// and the embedded subset font has no `cmap` table to recover from. The
/// resulting ciphertext is 100% printable ASCII, so it must be caught by the
/// substitution-cipher statistics and routed to OCR instead of served silently.
#[test]
fn test_extract_pages_mem_shifted_cipher_tounicode_needs_ocr() {
let buf = std::fs::read("tests/fixtures/shifted_cipher_tounicode.pdf").unwrap();
let result = extract_pages_markdown_mem(&buf, None).unwrap();
assert_eq!(result.pages.len(), 1);
assert!(
result.pages[0].needs_ocr,
"shifted-cipher garbled page should be flagged needs_ocr"
);
assert!(
result.pages[0].markdown.is_empty(),
"garbled markdown should be suppressed"
);
assert_eq!(result.pages_needing_ocr, vec![1]);
assert_eq!(
result.pages[0].ocr_reason.as_deref(),
Some("suspected_garbled_text")
);
}
#[test]
fn test_extract_regions_mem_multiple_regions_per_page() {
let buf = std::fs::read("tests/fixtures/nexo-price-en.pdf").unwrap();
+2 -2
View File
@@ -188,7 +188,7 @@
|156|23/7|General renovation works to Block B at Belonie Secondary School|MOE|Belvedere Builders|SR869,505.75|
|157|30/7|Procurement of Engine Block and Crankshaft for Engine A11|PUC|Ras Tek Pvt Ltd|Euro798,650.00|
|158|30/7|procurement of Wartsila Engine spares|PUC|Wartsila Eastern Africa ltd|Euro158,424.00|
|159|30/7|Proposed walkway, Drain, rock armoring , road and Bridge widening at Anse Talbot( Ex-Golden Egg)|SLTA|G&S Enterpise|SR1,113,010.00|
|159|30/7|Proposed walkway, Drain, rock armoring, road and Bridge widening at Anse Talbot( Ex-Golden Egg)|SLTA|G&S Enterpise|SR1,113,010.00|
|160|30/7|Procurement of transfer pump control panel|PUC|CA Engineering Consultancy Pte Ltd|SGD14,600.00|
|161|30/7|Consultancy service for North to South Victoria Bye- Pass road and utilities organisation|MLUH|Sonnel Seychelles LTD|SR1,332,000.00|
|162 AUG|30/7|Procurement of the supply of sodium cardonate|PUC|HPL Chemical LTD|USD42,600.00|
@@ -237,7 +237,7 @@
|201|24/9|Procurement of vehicle x 2|SLTA|Abhaye Valabhji Pty Ltd|SR1000.000.00|
||OCT|||||
|202|1/10|Proposed new traffic lane to 5th June Avenue|SLTA|Divy Constrution|SR2,864,589.00|
|203|1/10||Proposed Walkway, Drain, rock armoring , road and Bridge widening at Anse Talbot( Ex-Golden Egg) - Variations SLTA|G & S Enterprise|SR200,448.00|
|203|1/10||Proposed Walkway, Drain, rock armoring, road and Bridge widening at Anse Talbot(Ex-Golden Egg) - Variations SLTA|G & S Enterprise|SR200,448.00|
|204|1/10|Proposed Reconstrcution of Burnt House-Au Cap|MLUH|Furui Construction|SR946,130.00|
|205|1/10|Variation on the project associated with the procurement of seven 100m3/day containerised plant|PUC|Tornado Group (UAE)|USD172,500.00|
|206|1/10|Works on the breaker system at Bel Omber desalination plant|PUC|United Concrete Products (Sey)Ltd|SR1,998,993.11|
+15 -15
View File
@@ -10,7 +10,7 @@ Department of the Treasury **Internal Revenue Service**
### This publication contains:
**Form 4070A, Employees Daily Record of** Tips **Form 4070, Employees Report of Tips to** Employer
**Form 4070A,** Employees Daily Record of Tips **Form 4070,** Employees Report of Tips to Employer
For the period
@@ -22,7 +22,7 @@ Name and address of employee
**Publication 1244 (Rev. 7-96)** Cat. No. 44472W
**Instructions** You must keep sufficient proof to show the amount of your tip income for the year. A daily record of your tip income is considered sufficient proof. Keep a daily record for each workday showing the amount of cash and credit card tips received directly from customers or other employees. Also keep a record of the amount of tips, if any, you paid to other employees through tip sharing, tip pooling or other arrangements, and the names of employees to whom you paid tips. Show the date that each entry is made. This date should be on or near the date you received the tip income. You may use Form 4070A, Employees Daily Record of Tips, or any other daily record to record your tips. **Reporting Tips to Your Employer.—If you** receive tips that total $20 or more for any month while working for one employer, you must report the tips to your employer. Tips include cash left by customers, tips customers add to credit card charges, and tips you receive from other employees. You must report your tips for any one month by the 10th day of the next month. If the 10th day falls on a Saturday, Sunday, or legal holiday, you may give the report to your employer on the next business day that is not a Saturday, Sunday, or legal holiday. You must report tips that total $20 or more every month regardless of your total wages and tips for the year. You may use Form 4070, Employees Report of Tips to Employer, to report your tips to your employer. See the instructions on the back of Form 4070. You must include all tips, including tips not reported to your employer, as wages on your income tax return. You may use the last page of this publication to total your tips for the year. Your employer must withhold income, social security, and Medicare (or railroad retirement) taxes on tips you report. Your employer usually deducts the withholding due on tips from your regular wages.
**Instructions** You must keep sufficient proof to show the amount of your tip income for the year. A daily record of your tip income is considered sufficient proof. Keep a daily record for each workday showing the amount of cash and credit card tips received directly from customers or other employees. Also keep a record of the amount of tips, if any, you paid to other employees through tip sharing, tip pooling or other arrangements, and the names of employees to whom you paid tips. Show the date that each entry is made. This date should be on or near the date you received the tip income. You may use **Form 4070A**, Employees Daily Record of Tips, or any other daily record to record your tips. **Reporting Tips to Your Employer.—**If you receive tips that total $20 or more for any month while working for one employer, you must report the tips to your employer. Tips include cash left by customers, tips customers add to credit card charges, and tips you receive from other employees. You must report your tips for any one month by the 10th day of the next month. If the 10th day falls on a Saturday, Sunday, or legal holiday, you may give the report to your employer on the next business day that is not a Saturday, Sunday, or legal holiday. You must report tips that total $20 or more every month regardless of your total wages and tips for the year. You may use **Form 4070**, Employees Report of Tips to Employer, to report your tips to your employer. See the instructions on the back of Form 4070. You must include all tips, including tips not reported to your employer, as wages on your income tax return. You may use the last page of this publication to total your tips for the year. Your employer must withhold income, social security, and Medicare (or railroad retirement) taxes on tips you report. Your employer usually deducts the withholding due on tips from your regular wages.
*(continued on inside of back cover)*
@@ -30,14 +30,14 @@ Form **4070A** Employees Daily Record of Tips (Rev. July 1996) **This is a vo
Establishment name (if different)
Date Date **a. Tips received**
Date Date **a.** Tips received
**b. Credit card tips c. Tips paid out to d. Names of employees to whom you**
**b.** Credit card tips **c.** Tips paid out to **d.** Names of employees to whom you
tips of directly from customers received other employees paid tips recd. entry and other employees 1 2 3 4 5 **Subtotals** **For Paperwork Reduction Act Notice, see Instructions on the back of Form 4070. Page 1**
Date Date **a. Tips received**
Date Date **a.** Tips received
**b. Credit card tips c. Tips paid out to d. Names of employees to whom you**
**b.** Credit card tips **c.** Tips paid out to **d.** Names of employees to whom you
tips of directly from customers received other employees paid tips recd. entry and other employees
7 8 9 10 11 12 13 14 15 **Subtotals**
@@ -50,9 +50,9 @@ tips of directly from customers received other employees paid tips recd. entr
27 28 29 30 31 **Subtotals** **from pages** **1, 2, and 3** **Totals**
**1.** Report total cash tips (col. a) on Form 4070, line 1.
**2.** Report total credit card tips (col. b) on Form 4070, line 2.
**3.** Report total tips paid out (col. c) on Form 4070, line 3. **Page 4**
**1.** Report total cash tips (col. **a**) on Form 4070, line **1.**
**2.** Report total credit card tips (col. **b**) on Form 4070, line **2.**
**3.** Report total tips paid out (col. **c**) on Form 4070, line **3.** **Page 4**
Form Employees Report (Rev. July 1996)
@@ -66,17 +66,17 @@ Employers name and address (include establishment name, if different) **1** C
**3** Tips paid out
Month or shorter period in which tips were received **4** Net tips (lines 1 + 2 - 3) from, 19, to, 19 Signature Date
Month or shorter period in which tips were received **4** Net tips (lines **1 + 2 - 3**) from, 19, to, 19 Signature Date
**Paperwork Reduction Act Notice.—We ask for the** information on these forms to carry out the Internal Revenue laws of the United States. You are required to give us the information. We need it to ensure that you are complying with these laws and to allow us to figure and collect the right amount of tax. You are not required to provide the information requested on a form that is subject to the Paperwork Reduction Act unless the form displays a valid OMB control number. Books or records relating to a form or its instructions must be retained as long as their contents may become material in the administration of any Internal Revenue law. Generally, tax returns and return information are confidential, as required by Code section 6103. The time needed to complete Forms 4070 and 4070A will vary depending on individual circumstances. The estimated average times are: Recordkeeping—Form 4070, 7 min.; Form 4070A, 3 hr. and 23 min.; Learning **about the law—each form, 2 min.; Preparing Form 4070,** 13 min.; Form 4070A, 55 min.; and Copying and **providing Form 4070, 10 min.; Form 4070A, 14 min.** If you have comments concerning the accuracy of these time estimates or suggestions for making these
**Paperwork Reduction Act Notice.—**We ask for the information on these forms to carry out the Internal Revenue laws of the United States. You are required to give us the information. We need it to ensure that you are complying with these laws and to allow us to figure and collect the right amount of tax. You are not required to provide the information requested on a form that is subject to the Paperwork Reduction Act unless the form displays a valid OMB control number. Books or records relating to a form or its instructions must be retained as long as their contents may become material in the administration of any Internal Revenue law. Generally, tax returns and return information are confidential, as required by Code section 6103. The time needed to complete Forms 4070 and 4070A will vary depending on individual circumstances. The estimated average times are: **Recordkeeping**—Form 4070, 7 min.; Form 4070A, 3 hr. and 23 min.; **Learning** **about the law**—each form, 2 min.; **Preparing** Form 4070, 13 min.; Form 4070A, 55 min.; and **Copying and** **providing** Form 4070, 10 min.; Form 4070A, 14 min. If you have comments concerning the accuracy of these time estimates or suggestions for making these
forms simpler, we would be happy to hear from you. You can write to the Tax Forms Committee, Western Area Distribution Center, Rancho Cordova, CA 95743-0001. **Purpose.—Use this form to report tips you receive to** your employer. This includes cash tips, tips you receive from other employees, and credit card tips. You must report tips every month regardless of your total wages and tips for the year. However, you do not have to report tips to your employer for any month you received less than $20 in tips while working for that employer. Report tips by the 10th day of the month following the month that you receive them. If the 10th day is a Saturday, Sunday, or legal holiday, report tips by the next day that is not a Saturday, Sunday, or legal holiday. See Pub. 531, Reporting Tip Income, for more information. You can get additional copies of Pub. 1244, Employees Daily Record of Tips and Report to Employer, which contains both Forms 4070A and 4070, by calling 1-800-TAX-FORM (1-800-829-3676).
forms simpler, we would be happy to hear from you. You can write to the Tax Forms Committee, Western Area Distribution Center, Rancho Cordova, CA 95743-0001. **Purpose.—**Use this form to report tips you receive to your employer. This includes cash tips, tips you receive from other employees, and credit card tips. You must report tips every month regardless of your total wages and tips for the year. However, you do not have to report tips to your employer for any month you received less than $20 in tips while working for that employer. Report tips by the 10th day of the month following the month that you receive them. If the 10th day is a Saturday, Sunday, or legal holiday, report tips by the next day that is not a Saturday, Sunday, or legal holiday. See **Pub. 531**, Reporting Tip Income, for more information. You can get additional copies of **Pub. 1244**, Employees Daily Record of Tips and Report to Employer, which contains both Forms 4070A and 4070, by calling 1-800-TAX-FORM (1-800-829-3676).
**Instructions (continued)**
**Instructions** *(continued)*
**Unreported Tips.—If you received tips of $20 or** more for any month while working for one employer but did not report them to your employer, you must figure and pay social security and Medicare taxes on the unreported tips when you file your tax return. If you have unreported tips, you must use Form 1040 and Form 4137, Social Security and Medicare Tax on Unreported Tip Income, to report them. You may not use Form 1040A or 1040EZ. Employees subject to the Railroad Retirement Tax Act cannot use Form 4137 to pay railroad retirement tax on unreported tips. To get railroad retirement credit, you must report tips to your employer. If you do not report tips to your employer as required, you may be charged a penalty of 50% of the social security and Medicare taxes (or railroad retirement tax) due on the unreported tips unless there was reasonable cause for not reporting them. **Additional Information.—Get Pub. 531, Reporting** Tip Income, and Form 4137 for more information on tips. If you are an employee of certain large food or beverage establishments, see Pub. 531 for tip allocation rules. **Recordkeeping.—If you do not keep a daily** record of tips, you must keep other reliable proof of the tip income you received. This proof includes copies of restaurant bills and credit card charges that show amounts customers added as tips. Keep your tip income records for as long as the information on them may be needed in the administration of any Internal Revenue law.
**Unreported Tips.—**If you received tips of $20 or more for any month while working for one employer but did not report them to your employer, you must figure and pay social security and Medicare taxes on the unreported tips when you file your tax return. If you have unreported tips, you **must** use Form 1040 and **Form 4137,** Social Security and Medicare Tax on Unreported Tip Income, to report them. You may **not** use Form 1040A or 1040EZ. Employees subject to the Railroad Retirement Tax Act **cannot** use Form 4137 to pay railroad retirement tax on unreported tips. To get railroad retirement credit, you must report tips to your employer. If you do not report tips to your employer as required, you may be charged a penalty of 50% of the social security and Medicare taxes (or railroad retirement tax) due on the unreported tips unless there was reasonable cause for not reporting them. **Additional Information.—**Get **Pub. 531,** Reporting Tip Income, and Form 4137 for more information on tips. If you are an employee of certain large food or beverage establishments, see Pub. 531 for tip allocation rules. **Recordkeeping.—**If you do not keep a daily record of tips, you must keep other reliable proof of the tip income you received. This proof includes copies of restaurant bills and credit card charges that show amounts customers added as tips. Keep your tip income records for as long as the information on them may be needed in the administration of any Internal Revenue law.
### Instructions (continued)
**Instructions** *(continued)*
Use this space to total your tips for the year
+5 -3
View File
@@ -6,7 +6,7 @@
8 4 Z E L L / L U R I E R E A L E S T A T E C E N T E R
**Table I: Cap rate correlations** **Cap Rate Correlation With:*** **BBB Corp** **10-Year Bond Yield S&P Dividend** **Treasury (10-15 yr) Yield** Multifamily 0.187 0.771 0.068 Industrial-0.221 0.748-0.307 CBD Office-0.449 0.694-0.458 Retail-0.181 0.649-02.58
**Table I:** Cap rate correlations **Cap Rate Correlation With:*** **BBB Corp** **10-Year Bond Yield S&P Dividend** **Treasury (10-15 yr) Yield** Multifamily 0.187 0.771 0.068 Industrial-0.221 0.748-0.307 CBD Office-0.449 0.694-0.458 Retail-0.181 0.649-02.58
* Based on 25 years of data for the 10-yrT & S&P DivYld; and 14 years for BBB.
**Figure 1:** NCREIF cap rates vs. 10-yearTreasury
@@ -20,7 +20,9 @@ R E V I E W 8 5
**Figure 2:** Capratespreadsover10-yearTreasury
**Basis Points -200** -400
**Basis Points** -200
-400
-600
@@ -32,7 +34,7 @@ R E V I E W 8 5
1982 1986 1990 1994 1998 2002 2006
**Table II: Correlationsofspreadsbypropertytype** **Correlation of Cap Rate Spreads Over Treasury** **Multifamily Industrial CBD Office**
**Table II:** Correlationsofspreadsbypropertytype **Correlation of Cap Rate Spreads Over Treasury** **Multifamily Industrial CBD Office**
||Multifamily|Industrial|CBD Office|
|---|---|---|---|
+16 -16
View File
@@ -1,8 +1,8 @@
(e) [Reserved]. For further guidance, see §1.1563-3T(e)(1). Par. 50. Section 1.1563-3T is added to read as follows:
§1.1563-3T Rules for determining stock ownership (temporary).
<u>§1.1563-3T Rules for determining stock ownership (temporary)</u>.
(a) through (d)(2)(iii) [Reserved]. For further guidance, see §1.1563-3(a)
through (d)(2)(iii). (iv) Statement. If the application of paragraph (d)(2)(ii) or (iii) of §1.1563-3 does not result in a corporation being treated as a component member of only one controlled group of corporations on a December 31, then such corporation will be treated as a component member of only one such group on such date. Such corporation may elect the group in which it is to be included by including on or with its income tax return a statement entitled, “STATEMENT TO ELECT CONTROLLED GROUP PURSUANT TO §1.1563-3T(d)(2)(iv).” The statement must include--
through (d)(2)(iii). (iv) <u>Statement</u>. If the application of paragraph (d)(2)(ii) or (iii) of §1.1563-3 does not result in a corporation being treated as a component member of only one controlled group of corporations on a December 31, then such corporation will be treated as a component member of only one such group on such date. Such corporation may elect the group in which it is to be included by including on or with its income tax return a statement entitled, “STATEMENT TO ELECT CONTROLLED GROUP PURSUANT TO §1.1563-3T(d)(2)(iv).” The statement must include--
(A) A description of each of the controlled groups in which the corporation
could be included. The description must include the name and employer identification number of each component member of each such group and the stock ownership of the component members of each such group; and
@@ -10,7 +10,7 @@ could be included. The description must include the name and employer identifica
(B) The following representation: [INSERT NAME AND EMPLOYER
IDENTIFICATION NUMBER OF CORPORATION] ELECTS TO BE TREATED AS A COMPONENT MEMBER OF THE [INSERT DESIGNATION OF GROUP].
(v) Election-- (A) Election filed. An election filed under paragraph (d)(2)(iv) of
(v) <u>Election</u>-- (A) <u>Election filed</u>. An election filed under paragraph (d)(2)(iv) of
this section is irrevocable and effective until paragraph (d)(2)(ii) or (iii) of §1.1563-3 applies or until a change in the stock ownership of the corporation results in
|termination of membership in the controlled group in which such corporation has||
@@ -30,47 +30,47 @@ Federal income tax return (including any amended return filed on or before the d
2006.
(2) Expiration date. The applicability of this section will expire on May 26,
2009. Par. 51. Section 1.6012-2 is amended by revising paragraph (c) and adding paragraph (k) to read as follows: §1.6012-2 Corporations required to make returns of income.
2009. Par. 51. Section 1.6012-2 is amended by revising paragraph (c) and adding paragraph (k) to read as follows: <u>§1.6012-2 Corporations required to make returns of income</u>.
* * * * *
(c) [Reserved]. For further guidance, see §1.6012-2T(c).
* * * * *
(k) [Reserved]. For further guidance, see §1.6012-2T(k)(1).
Par. 52. Section 1.6012-2T is added to read as follows: §1.6012-2T Corporations required to make returns of income (temporary).
Par. 52. Section 1.6012-2T is added to read as follows: <u>§1.6012-2T Corporations required to make returns of income (temporary)</u>.
(a) through (b) [Reserved]. For further guidance, see §1.6012-2(a) through
(b).
(c) Insurance companies-- (1) Domestic life insurance companies-- (i) In
general. A life insurance company subject to tax under section 801 shall make a return on Form 1120L. Except as provided in paragraph (c)(4) of this section, such company shall file with its return--
<u>general</u>. A life insurance company subject to tax under section 801 shall make a return on Form 1120L. Except as provided in paragraph (c)(4) of this section, such company shall file with its return--
(A) A copy of its annual statement which shows the reserves used by the
company in computing the taxable income reported on its return; and
(B) A copy of Schedule A (real estate) and of Schedule D (bonds and stocks),
or any successor thereto, of such annual statement. (ii) Mutual savings banks. Mutual savings banks conducting life insurance business and meeting the requirements of section 594 are subject to partial tax computed on Form 1120 and partial tax computed on Form 1120L. The Form 1120L is attached as a schedule to Form 1120, together with the annual statement and schedules required to be filed with Form 1120L.
or any successor thereto, of such annual statement. (ii) <u>Mutual savings banks</u>. Mutual savings banks conducting life insurance business and meeting the requirements of section 594 are subject to partial tax computed on Form 1120 and partial tax computed on Form 1120L. The Form 1120L is attached as a schedule to Form 1120, together with the annual statement and schedules required to be filed with Form 1120L.
(2) Domestic nonlife insurance companies. Every domestic insurance
(2) <u>Domestic nonlife insurance companies</u>. Every domestic insurance
company other than a life insurance company shall make a return on Form 1120PC. This includes organizations described in section 501(m)(1) that provide commercial- type insurance and organizations described in section 833. Except as provided in paragraph (c)(4) of this section, such company shall file with its return a copy of its
annual statement (or a pro forma annual statement), including the underwriting and investment exhibit for the year covered by such return.
(3) Foreign insurance companies. The provisions of paragraphs (c)(1) and
(3) <u>Foreign insurance companies</u>. The provisions of paragraphs (c)(1) and
(c)(2) of this section concerning the returns and statements of insurance companies subject to tax under section 801 or section 831 also apply to foreign insurance companies subject to tax under those sections, except that the copy of the annual statement required to be submitted with the return shall, in the case of a foreign insurance company that is not required to file an annual statement, be a copy of the pro forma annual statement relating to the United States business of such company.
(4) Exception for insurance companies filing their Federal income tax returns
electronically. If an insurance company described in paragraph (c)(1), (c)(2), or
(4) <u>Exception for insurance companies filing their Federal income tax returns</u>
<u>electronically</u>. If an insurance company described in paragraph (c)(1), (c)(2), or
(c)(3) of this section files its Federal income tax return electronically, it should not include on or with such return its annual statement (or pro forma annual statement), or any portion thereof. Such statement must be available at all times for inspection by authorized Internal Revenue Service officers or employees and retained for so long as such statements may be material in the administration of any internal revenue law. See §1.6001-1(e).
(5) Definition. For purposes of this section, the term annual statement means
(5) <u>Definition</u>. For purposes of this section, the term <u>annual statement</u> means
the annual statement, the form of which is approved by the National Association of Insurance Commissioners (NAIC), which is filed by an insurance company for the year with the insurance departments of States, Territories, and the District of
Columbia. The term annual statement also includes a pro forma annual statement if the insurance company is not required to file the NAIC annual statement.
(d) through (j) [Reserved]. For further guidance, see §1.6012-2(d) through (j).
(k) Effective date-- (1) Applicability date. This section applies to any original
(k) <u>Effective date</u>-- (1) <u>Applicability date</u>. This section applies to any original
Federal income tax return (including any amended return filed on or before the due date (including extensions) of such original return) timely filed on or after May 30,
2006.
(2) Expiration date. The applicability of this section will expire on May 26,
(2) <u>Expiration date</u>. The applicability of this section will expire on May 26,
2009.
|||Par. 53. For each entry in the “Location” column of the following table,|
@@ -165,7 +165,7 @@ section and paragraph
PART 602--OMB CONTROL NUMBERS UNDER THE PAPERWORK REDUCTION ACT Par. 54. The authority citation for part 602 continues to read as follows: Authority: 26 U.S.C. 7805. Par. 55. In §602.101, paragraph (b) is amended to read as follows:
1. The following entries to the table are removed:
§602.101 OMB Control numbers.
<u>§602.101 OMB Control numbers</u>.
* * * * *
(b) * * *
@@ -180,7 +180,7 @@ CFR part or section where Current OMB identified or described control No.
1.1081-11………………………………………………………………. 1545-2019
* * * * * **______________________________________________________________**
2. The following entries are added in numerical order to the table:
§602.101 OMB Control numbers.
<u>§602.101 OMB Control numbers</u>.
* * * * *
(b) * * *
+2 -2
View File
@@ -26,7 +26,7 @@ A.P., NIST Standard Reference in cubic meters per kilogram Database 23, NIST the
##### Physical Properties
|Chemical Formula|CCl2F2|
|Chemical Formula|CCl₂F₂|
|---|---|
|Molecular mass|120.91|
|Boiling Point At one atmosphere|-29.75°C|
@@ -45,7 +45,7 @@ l
|Temp|Pressure||Volume|||Density||Enthalpy|||Entropy|Temp|
|---|---|---|---|---|---|---|---|---|---|---|---|---|
|°C|[kPa]|[m3 Liquid v f|/kg]|Vapour v g|Liquid d f|[kg/m3] Vapour d g|Liquid H f|[kJ/kg] Latent H fg|Vapour H g|Liquid S f|[kJ/K-kg] Vapour S g|°C|
|°C|[kPa]|[m³ Liquid v f|/kg]|Vapour v g|Liquid d f|[kg/m³] Vapour d g|Liquid H f|[kJ/kg] Latent H fg|Vapour H g|Liquid S f|[kJ/K-kg] Vapour S g|°C|
|-100|1.2|0.0006|10.0000|1679.0|0.100|113.3|192.8|306.1|0.6077|1.7210|-100|
|---|---|---|---|---|---|---|---|---|---|---|---|